Protein
MCA_04154_1
Length
185 amino acids
Gene name: CGI121
Description: EKC/KEOPS complex subunit CGI121
Browser: contigC:2206566-2207354-
RNA-seq: read pairs 732, FPKM 48.6, percentile rank 64.8% (100% = highest expression)
Protein function
| Annotation: | CGI121 | EKC/KEOPS complex subunit CGI121 | |
|---|---|---|---|
| KEGG: | K15901 | CGI121 | EKC/KEOPS complex subunit CGI121/TPRKB |
| EGGNOG: | 0PPXT | CGI121 | Component of the EKC KEOPS complex which promotes both telomere uncapping and telomere elongation (By similarity). The complex is required for efficient recruitment of transcriptional coactivators (By similarity) |
| SGD closest match: | S000004500 | CGI121 | EKC/KEOPS complex subunit CGI121 |
| CGD closest match: | CAL0000182468 | CGI121 | EKC/KEOPS complex subunit CGI121 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02326_1 | 59.07% | 193 | 1e-70 | MIA_02326_1 |
| A0A060TEH1_BLAAD | 44.32% | 176 | 3e-45 | ARAD1D07370p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D07370g PE=3 SV=1 |
| UniRef50_A0A060TEH1 | 44.32% | 176 | 8e-42 | ARAD1D07370p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060TEH1_BLAAD |
| A0A0J9XAH0_GEOCN | 41.76% | 182 | 1e-43 | Similar to Saccharomyces cerevisiae YML036W CGI121 Component of the EKC/KEOPS complex with Bud32p OS=Geotrichum candidum GN=BN980_GECA07s01880g PE=3 SV=1 |
| CG121_YARLI | 48.00% | 175 | 4e-41 | EKC/KEOPS complex subunit CGI121 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CGI121 PE=3 SV=1 |
| A0A1E3PEU5_9ASCO | 41.34% | 179 | 5e-37 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52922 PE=3 SV=1 |
| CG121_YEAST | 36.61% | 183 | 8e-27 | EKC/KEOPS complex subunit CGI121 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CGI121 PE=1 SV=1 |
| CG121_CANAL | 39.62% | 106 | 6e-19 | EKC/KEOPS complex subunit CGI121 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CGI121 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0127
Protein family membership
- CGI121/TPRKB (IPR013926)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_04154_1 MSDQQALSITTKFPQFPDYSILISLFENVKNARFIRSQLLNGNQEYEYAFVNPSTVYSLDQLLVAVYRAINDTTAGYMRT KNIHSEVVFCLSPNNNIMDGLRRFGITDNSDKIIAIKVVKNEDYKPYLDFLLKNIEGQEVKLTLEKLKDLSDLKLIKKNY KLPATMEKPKEINDNIITSISLRGA
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.