Protein
MIA_02316_1
Length
80 amino acids
Browser: contig03:453402-453824+
Protein function
| EGGNOG: | 0PT39 | FG09667.1 | Ubiquinol-cytochrome-c reductase complex subunit (QCR10) |
|---|---|---|---|
| SGD closest match: | S000003529 | QCR10 | Cytochrome b-c1 complex subunit 10 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_05386_1 | 75.000% | 80 | 2.54e-41 | MCA_05386_1 |
| A0A0J9X5S7_GEOCN | 65.000% | 80 | 6.13e-29 | Similar to Saccharomyces cerevisiae YHR001W-A QCR10 Subunit of the ubiqunol-cytochrome c oxidoreductase complex which includes Cobp, Rip1p, Cyt1p, Cor1p, Qcr2p,Qcr6p, Qcr7p, Qcr8p, Qcr9p, and Qcr10p OS=Geotrichum candidum GN=BN980_GECA02s05691g PE=4 SV=1 |
| UniRef50_A0A0J9X5S7 | 65.000% | 80 | 1.25e-25 | Similar to Saccharomyces cerevisiae YHR001W-A QCR10 Subunit of the ubiqunol-cytochrome c oxidoreductase complex which includes Cobp, Rip1p, Cyt1p, Cor1p, Qcr2p,Qcr6p, Qcr7p, Qcr8p, Qcr9p, and Qcr10p n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X5S7_GEOCN |
| A0A1E3PJF1_9ASCO | 43.750% | 80 | 4.46e-25 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51928 PE=4 SV=1 |
| Q6CC60_YARLI | 41.250% | 80 | 5.18e-22 | YALI0C12210p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C12210g PE=4 SV=2 |
| A0A060T7C2_BLAAD | 40.000% | 80 | 6.17e-17 | ARAD1B22528p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B22528g PE=4 SV=1 |
| A0A1E4T9I2_9ASCO | 28.205% | 78 | 1.07e-13 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_29624 PE=4 SV=1 |
| QCR10_YEAST | 25.397% | 63 | 3.59e-08 | Cytochrome b-c1 complex subunit 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR10 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5821
Protein family membership
- Cytochrome b-c1 complex subunit 10, fungi (IPR019182)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_02316_1 MAAKQYKLAPAYKPVPHLLNFTIANTLKWSPILAFWGGSALAGVLFFADSIPRLQRDIFQYLPLIGSSYVKNVPASDSPF
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.