Protein

MIA_02316_1

Length
80 amino acids


Browser: contig03:453402-453824+

Protein function

EGGNOG:0PT39FG09667.1Ubiquinol-cytochrome-c reductase complex subunit (QCR10)
SGD closest match:S000003529QCR10Cytochrome b-c1 complex subunit 10

Protein alignments

%idAln lengthE-value
MCA_05386_175.000%802.54e-41MCA_05386_1
A0A0J9X5S7_GEOCN65.000%806.13e-29Similar to Saccharomyces cerevisiae YHR001W-A QCR10 Subunit of the ubiqunol-cytochrome c oxidoreductase complex which includes Cobp, Rip1p, Cyt1p, Cor1p, Qcr2p,Qcr6p, Qcr7p, Qcr8p, Qcr9p, and Qcr10p OS=Geotrichum candidum GN=BN980_GECA02s05691g PE=4 SV=1
UniRef50_A0A0J9X5S765.000%801.25e-25Similar to Saccharomyces cerevisiae YHR001W-A QCR10 Subunit of the ubiqunol-cytochrome c oxidoreductase complex which includes Cobp, Rip1p, Cyt1p, Cor1p, Qcr2p,Qcr6p, Qcr7p, Qcr8p, Qcr9p, and Qcr10p n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X5S7_GEOCN
A0A1E3PJF1_9ASCO43.750%804.46e-25Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51928 PE=4 SV=1
Q6CC60_YARLI41.250%805.18e-22YALI0C12210p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C12210g PE=4 SV=2
A0A060T7C2_BLAAD40.000%806.17e-17ARAD1B22528p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B22528g PE=4 SV=1
A0A1E4T9I2_9ASCO28.205%781.07e-13Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_29624 PE=4 SV=1
QCR10_YEAST25.397%633.59e-08Cytochrome b-c1 complex subunit 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR10 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.5821

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Protein sequence

>MIA_02316_1
MAAKQYKLAPAYKPVPHLLNFTIANTLKWSPILAFWGGSALAGVLFFADSIPRLQRDIFQYLPLIGSSYVKNVPASDSPF

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.