Protein
MCA_05386_1
Length
80 amino acids
Browser: contigD:1197908-1198368-
RNA-seq: read pairs 24304, FPKM 3707.4, percentile rank 99.0% (100% = highest expression)
Protein function
SGD closest match: | S000003529 | QCR10 | Cytochrome b-c1 complex subunit 10 |
---|
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_02316_1 | 75.00% | 80 | 5e-40 | MIA_02316_1 |
A0A1E3PJF1_9ASCO | 42.50% | 80 | 1e-23 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51928 PE=4 SV=1 |
A0A0J9X5S7_GEOCN | 56.25% | 80 | 6e-22 | Similar to Saccharomyces cerevisiae YHR001W-A QCR10 Subunit of the ubiqunol-cytochrome c oxidoreductase complex which includes Cobp, Rip1p, Cyt1p, Cor1p, Qcr2p,Qcr6p, Qcr7p, Qcr8p, Qcr9p, and Qcr10p OS=Geotrichum candidum GN=BN980_GECA02s05691g PE=4 SV=1 |
UniRef50_A0A0J9X5S7 | 56.25% | 80 | 1e-18 | Similar to Saccharomyces cerevisiae YHR001W-A QCR10 Subunit of the ubiqunol-cytochrome c oxidoreductase complex which includes Cobp, Rip1p, Cyt1p, Cor1p, Qcr2p,Qcr6p, Qcr7p, Qcr8p, Qcr9p, and Qcr10p n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X5S7_GEOCN |
Q6CC60_YARLI | 43.42% | 76 | 1e-20 | YALI0C12210p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C12210g PE=4 SV=2 |
A0A060T7C2_BLAAD | 37.50% | 80 | 2e-14 | ARAD1B22528p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B22528g PE=4 SV=1 |
A0A1E4T9I2_9ASCO | 28.95% | 76 | 1e-13 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_29624 PE=4 SV=1 |
QCR10_YEAST | 28.00% | 75 | 2e-10 | Cytochrome b-c1 complex subunit 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR10 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5631
Protein family membership
- Cytochrome b-c1 complex subunit 10, fungi (IPR019182)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_05386_1 MAVYSYKSSAAYKPVPHFLNFTASNAVKWAPILGFWGGSALVGVLFFADSIPRLKKDIFQYLPVIGSIYVDNTPASDSPF
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.