MCA_05386_1

Protein

Length

80 amino acids

Browser: contigD:1197908-1198368-

RNA-seq: read pairs 24304, FPKM 3707.4, percentile rank 99.0% (100% = highest expression)

SGD closest match:	S000003529	QCR10	Cytochrome b-c1 complex subunit 10

	%id	Aln length	E-value
MIA_02316_1	75.00%	80	5e-40	MIA_02316_1
A0A1E3PJF1_9ASCO	42.50%	80	1e-23	Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51928 PE=4 SV=1
A0A0J9X5S7_GEOCN	56.25%	80	6e-22	Similar to Saccharomyces cerevisiae YHR001W-A QCR10 Subunit of the ubiqunol-cytochrome c oxidoreductase complex which includes Cobp, Rip1p, Cyt1p, Cor1p, Qcr2p,Qcr6p, Qcr7p, Qcr8p, Qcr9p, and Qcr10p OS=Geotrichum candidum GN=BN980_GECA02s05691g PE=4 SV=1
UniRef50_A0A0J9X5S7	56.25%	80	1e-18	Similar to Saccharomyces cerevisiae YHR001W-A QCR10 Subunit of the ubiqunol-cytochrome c oxidoreductase complex which includes Cobp, Rip1p, Cyt1p, Cor1p, Qcr2p,Qcr6p, Qcr7p, Qcr8p, Qcr9p, and Qcr10p n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X5S7_GEOCN
Q6CC60_YARLI	43.42%	76	1e-20	YALI0C12210p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C12210g PE=4 SV=2
A0A060T7C2_BLAAD	37.50%	80	2e-14	ARAD1B22528p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B22528g PE=4 SV=1
A0A1E4T9I2_9ASCO	28.95%	76	1e-13	Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_29624 PE=4 SV=1
QCR10_YEAST	28.00%	75	2e-10	Cytochrome b-c1 complex subunit 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR10 PE=1 SV=2

Probability of mitochondrial location: 0.5631

None predicted.

no IPR

Unintegrated signatures

>MCA_05386_1
MAVYSYKSSAAYKPVPHFLNFTASNAVKWAPILGFWGGSALVGVLFFADSIPRLKKDIFQYLPVIGSIYVDNTPASDSPF

None predicted.

None predicted.

None predicted.

Filter view on