Protein

MIA_02293_1

Length
111 amino acids

Browser: contig03:372519-372913+

Protein function

EGGNOG:0PQY5PGUG_00372L51_S25_CI-B8
CGD closest match:CAL0000179541orf19.6898.1Uncharacterized protein

Protein alignments

%idAln lengthE-value
MCA_04272_163.810%1053.10e-44MCA_04272_1
A0A0J9XIK9_GEOCN56.604%1061.05e-37NI8M subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA19s00890g PE=4 SV=1
A0A060T9N3_BLAAD51.852%1081.95e-34ARAD1D19888p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D19888g PE=4 SV=1
UniRef50_B2AT3445.946%1115.08e-29Podospora anserina S mat+ genomic DNA chromosome 1, supercontig 4 n=7 Tax=leotiomyceta TaxID=716546 RepID=B2AT34_PODAN
A0A1E4TCR5_9ASCO43.519%1084.89e-28Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_27124 PE=4 SV=1
A0A1D8PQU3_CANAL47.664%1072.26e-25Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6898.1 PE=4 SV=1
Q6CD73_YARLI35.354%998.21e-18YALI0C03201p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C03201g PE=4 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.4297

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 111

Detailed signature matches

  1. Family IPR016464
    NADH dehydrogenase [ubiquinone] (complex I), alpha subcomplex, subunit 2
    1. PIRSF005822 (NDUA2)
  2. Domain IPR012336
    Thioredoxin-like fold
    1. SSF52833 (Thioredox...)
  3. Domain IPR007741
    Ribosomal protein/NADH dehydrogenase domain
    1. PF05047 (L51_S25_CI-B8)
    2. SM00916 (L51_S25_CI...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.30.10

Protein sequence

>MIA_02293_1
MSSKYVFPRALKELRFHFSQTGDASGPLRTFLTRAYPVIKKHNPSTPVLIREAAGVRPTLYARFGKSSRIRTRVNAMLTI
DVEFGREAKLSLEGVPEEQIEGAIQKLVANE

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.