Protein

MCA_04272_1

Length
94 amino acids

Description: Putative NADH-ubiquinone oxidoreductase subunit

Browser: contigC:2558983-2559462-

RNA-seq: read pairs 5893, FPKM 766.5, percentile rank 95.8% (100% = highest expression)

Protein function

Annotation:Putative NADH-ubiquinone oxidoreductase subunit
KEGG:K03946NDUFA2 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 2
EGGNOG:0PQY5PGUG_00372L51_S25_CI-B8
CGD closest match:CAL0000179541orf19.6898.1Uncharacterized protein

Protein alignments

%idAln lengthE-value
MIA_02293_163.81%1055e-43MIA_02293_1
A0A0J9XIK9_GEOCN66.67%901e-42NI8M subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA19s00890g PE=4 SV=1
A0A060T9N3_BLAAD55.32%941e-36ARAD1D19888p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D19888g PE=4 SV=1
UniRef50_W6QCQ260.47%865e-31NADH-ubiquinone oxidoreductase 10.5 kDa subunit n=35 Tax=leotiomyceta TaxID=716546 RepID=W6QCQ2_PENRF
A0A1D8PQU3_CANAL54.95%912e-28Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6898.1 PE=4 SV=1
A0A1E4TCR5_9ASCO45.24%843e-26Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_27124 PE=4 SV=1
Q6CD73_YARLI46.91%812e-22YALI0C03201p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C03201g PE=4 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3652

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 10 20 30 40 50 60 70 80 94

Detailed signature matches

  1. Family IPR016464
    NADH dehydrogenase [ubiquinone] (complex I), alpha subcomplex, subunit 2
    1. PIRSF005822 (NDUA2)
  2. Domain IPR012336
    Thioredoxin-like fold
    1. SSF52833 (Thioredox...)
  3. Domain IPR007741
    Ribosomal protein/NADH dehydrogenase domain
    1. PF05047 (L51_S25_CI-B8)
    2. SM00916 (L51_S25_CI...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.30.10

Protein sequence

>MCA_04272_1
MSSKYVFPKALKELRFHFSQTGEASAPLRTFLSRAYPVMKKHNPHTPVLIREAYGVKPTLFARYEFGKEAKFNLDGVSEN
QLESTIESALNKGN

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.