Protein

MIA_02287_1

Length
242 amino acids

Browser: contig03:363017-363746+

Protein function

EGGNOG:0PFN2MET8Siroheme synthase
SGD closest match:S000000417MET8Siroheme biosynthesis protein MET8
CGD closest match:CAL0000198876MET8Bifunctional precorrin-2 dehydrogenase/sirohydrochlorin ferrochelatase

Protein alignments

%idAln lengthE-value
MCA_05823_153.208%2652.07e-92MCA_05823_1
A0A0J9XH90_GEOCN53.282%2594.39e-86Similar to Saccharomyces cerevisiae YBR213W MET8 Bifunctional dehydrogenase and ferrochelatase OS=Geotrichum candidum GN=BN980_GECA16s02518g PE=4 SV=1
UniRef50_A0A0J9XH9053.282%2598.98e-83Similar to Saccharomyces cerevisiae YBR213W MET8 Bifunctional dehydrogenase and ferrochelatase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XH90_GEOCN
A0A167CD68_9ASCO44.255%2351.81e-63Bifunctional precorrin-2 dehydrogenase/sirohydrochlorin ferrochelatase MET8 OS=Sugiyamaella lignohabitans GN=MET8 PE=4 SV=1
A0A060T896_BLAAD37.500%2323.65e-48ARAD1D01892p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D01892g PE=4 SV=1
Q6C695_YARLI36.290%2484.13e-48YALI0E11385p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E11385g PE=4 SV=1
A0A1E3PKF5_9ASCO36.863%2556.11e-46Siroheme synthase middle domains-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51189 PE=4 SV=1
Q5ADR1_CANAL33.884%2427.30e-39Bifunctional precorrin-2 dehydrogenase/sirohydrochlorin ferrochelatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MET8 PE=4 SV=1
A0A1E4TGN5_9ASCO37.186%1999.27e-31Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_44538 PE=4 SV=1
MET8_YEAST28.814%2362.15e-21Siroheme biosynthesis protein MET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET8 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0314

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 242

Detailed signature matches

  1. Domain IPR016040
    NAD(P)-binding domain
    1. SSF51735 (NAD(P)-bi...)
  2. Domain IPR006367
    Sirohaem synthase, N-terminal
    1. PF13241 (NAD_binding_7)
    2. TIGR01470
  3. Domain IPR028281
    Siroheme synthase, central domain
    1. PF14824 (Sirohm_syn...)
  4. Domain IPR028162
    Siroheme biosynthesis protein Met8, C-terminal
    1. PF14823 (Sirohm_syn...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.10.32...
  2. G3DSA:3.30.16...
  3. G3DSA:3.40.50...
  4. SSF75615 (Siroheme ...)

Protein sequence

>MIA_02287_1
MNVSPGGSLIVAWQVKNRPVLVVGGGDVACGRVSSLLSADAVVTVVAPALPNPDLRSFIHSNPSSITYVDSTVTHDSIKD
LLSDSQGPRYSMVLTAIDAPDISRAIHAECKRVGIPVNIADVPPLCDFYFASTIRRGPLQVAVSTGGSAPRLARRIRLDI
ERGVDSLGDVEKAIENTAVLRAKLRVFTDANPQFHKSDQEKIRSRMAWMSRVCDSLLYTELADLSESTMDTMVAAYPNDP
LM

GO term prediction

Biological Process

GO:0006779 porphyrin-containing compound biosynthetic process
GO:0019354 siroheme biosynthetic process
GO:0055114 oxidation-reduction process

Molecular Function

GO:0043115 precorrin-2 dehydrogenase activity

Cellular Component

None predicted.