Protein

MIA_02213_1

Length
256 amino acids

Browser: contig03:143959-144798-

Protein function

EGGNOG:0PGC6UBC6ubiquitin-conjugating enzyme
SGD closest match:S000000902UBC6Ubiquitin-conjugating enzyme E2 6
CGD closest match:CAL0000184069orf19.7347E2 ubiquitin-conjugating protein

Protein alignments

%idAln lengthE-value
MCA_04051_172.050%1611.06e-86MCA_04051_1
A0A0J9XKZ6_GEOCN70.807%1616.69e-87Similar to Saccharomyces cerevisiae YER100W UBC6 Ubiquitin-conjugating enzyme involved in ER-associated protein degradation OS=Geotrichum candidum GN=BN980_GECA25s00670g PE=3 SV=1
UniRef50_C5DE6767.081%1612.45e-78KLTH0C06688p n=12 Tax=Ascomycota TaxID=4890 RepID=C5DE67_LACTC
UBC6_YEAST65.060%1665.03e-81Ubiquitin-conjugating enzyme E2 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC6 PE=1 SV=1
A0A060TIX1_BLAAD49.609%2565.14e-79ARAD1D41844p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D41844g PE=3 SV=1
A0A1E3PIA9_9ASCO63.975%1611.78e-74UBC-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83217 PE=3 SV=1
A0A1E4TH10_9ASCO66.026%1563.31e-75Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13864 PE=3 SV=1
Q6C431_YARLI67.832%1434.09e-73YALI0E30173p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E30173g PE=3 SV=2
A0A1D8PKG7_CANAL63.750%1601.43e-66E2 ubiquitin-conjugating protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.7347 PE=3 SV=1
A0A167C594_9ASCO62.366%936.36e-36E2 ubiquitin-conjugating protein UBC6 OS=Sugiyamaella lignohabitans GN=UBC6 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.4887

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 256

Detailed signature matches

  1. Domain IPR016135
    Ubiquitin-conjugating enzyme/RWD-like
    1. SSF54495 (UBC-like)
    2. G3DSA:3.10.11...
  2. Domain IPR000608
    Ubiquitin-conjugating enzyme E2
    1. PS50127 (UBIQUITIN_...)
    2. cd00195 (UBCc)
    3. PF00179 (UQ_con)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. NON_CYTOPLASM... (N...)
  3. SM00212 (ubc_7)
  4. TMhelix
  5. TRANSMEMBRANE (Tran...)
  6. mobidb-lite (disord...)

Residue annotation

  1. E3 interaction res...
  2. Ub thioester inter...
  3. active site cystei...

Protein sequence

>MIA_02213_1
MATRTASKRLAREYKSIQDTPVPYITAKPNEANILEWHYVLEGPPDTPYFGGQYHGILKFPADYPYAPPSIRMLTPSGRF
QPGMRLCLSISDYHPKSWNPAWSVSTILTGLISFMVSDEHTAGSITTSPETKKTLARASRKFNNTSNAQFREVFPELVEE
NKRALEAPESAGVASTSTPATVTATTATTANTTTSTPAKAPAPAPAGTVSGASDPGASRPGGGDNNNNNNGMSMSQKIIF
VSVLFVSWVIASRMFS

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.