Protein

MIA_02192_1

Length
768 amino acids


Browser: contig03:87009-89316-

Protein function

EGGNOG:0PGGKMEF1Mitochondrial GTPase that catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A- site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome (By similarity)
SGD closest match:S000004059MEF1Elongation factor G, mitochondrial
CGD closest match:CAL0000175777MEF1Elongation factor G, mitochondrial

Protein alignments

%idAln lengthE-value
MCA_04251_183.065%7440.0MCA_04251_1
A0A0J9X7Y3_GEOCN81.831%7320.0Elongation factor G, mitochondrial OS=Geotrichum candidum GN=MEF1 PE=3 SV=1
A0A060SXB9_BLAAD76.158%7340.0Elongation factor G, mitochondrial OS=Blastobotrys adeninivorans GN=MEF1 PE=3 SV=1
A0A167EQ65_9ASCO75.646%7350.0Elongation factor G, mitochondrial OS=Sugiyamaella lignohabitans GN=MEF1 PE=3 SV=1
A0A1E4TJ74_9ASCO74.194%7130.0Elongation factor G, mitochondrial OS=Tortispora caseinolytica NRRL Y-17796 GN=MEF1 PE=3 SV=1
EFGM_YEAST70.210%7620.0Elongation factor G, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEF1 PE=1 SV=2
UniRef50_P2503970.210%7620.0Elongation factor G, mitochondrial n=350 Tax=cellular organisms TaxID=131567 RepID=EFGM_YEAST
A0A1E3PE22_9ASCO73.773%7130.0Elongation factor G, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=MEF1 PE=3 SV=1
EFGM_CANAL68.970%7670.0Elongation factor G, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEF1 PE=3 SV=2
EFGM_YARLI68.289%7600.0Elongation factor G, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MEF1 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9877
Predicted cleavage: 37

Protein family membership

Domains and repeats

Detailed signature matches

    1. MF_00054_B (EF_G_EF...)
    1. SSF52540 (P-loop co...)
    1. PS51722 (G_TR_2)
    2. PF00009 (GTP_EFTU)
    3. PR00315 (ELONGATNFCT)
    1. SSF50447 (Translati...)
    1. PF03144 (GTP_EFTU_D2)
    1. SSF54980 (EF-G C-te...)
    1. cd16262 (EFG_III)
    1. SSF54211 (Ribosomal...)
    1. PF03764 (EFG_IV)
    2. cd01434 (EFG_mtEFG1_IV)
    3. SM00889 (EFG_IV_2)
    1. PF00679 (EFG_C)
    2. SM00838 (EFG_C_a)
    1. cd04097 (mtEFG1_C)
    1. PS00301 (G_TR_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PF14492 (EFG_II)
  2. cd01886 (EF-G)
  3. cd04091 (mtEFG1_II_...)

Residue annotation

  1. G1 box cd01886
  2. putative GEF inter...
  3. GTP/Mg2+ binding s...
  4. Switch I region cd...
  5. G2 box cd01886
  6. G3 box cd01886
  7. Switch II region c...
  8. G4 box cd01886
  9. G5 box cd01886

Protein sequence

>MIA_02192_1
MSVRAANYMAWKPLSLGLCRTAFKAPRSFVPRLAQNLFSTSSPCRTYEEERVVLDKIDAEMPEVDKTRLATLRNIGVSAH
IDSGKTTFTERVLYYTGRIKAIHEVRGRDNVGAKMDSMDLEREKGITIQSAATYCDWTRNHPDGTSKDFHFNLIDTPGHI
DFTIEVERALRVLDGAVLVVCAVSGVQSQTITVDRQMRRYNVPRVTFINKMDRMGANPWKAIDQVRTKLKIPAAAVQVPI
GAENDLQGSVDLIELVSVYNEGKQGEKIVVKKEIPPELQDLVDEKRALLIETLADVDDEMAEIFLDEQTPTPQQIRDAIR
RATIARKFTPVLMGSALANRGIQSVLDAVCDYLPNPGEILNSGLDAANNEAPVNLVPYQNSPFVGLAFKLEEGKYGQLTY
VRVYQGKLKKGMTIVNVKTGKRTKLARLARMHSDEMEDVDEICAGEICATFGVDCSSGDTFTDGELRYTMSSMFVPDPVI
SLSISPKTKDTNFSKAINRFQKEDPTFVVKFDSESKETIISGMGELHLEIYVERMKREYNVECITGKPQVAYRETVSMEV
PFDFTHKKQSGGAGQYAKVMGNLGQAASTEQNTFESQIVGGKIPEKFLAACEKGFFEACEKGPLTGHKVIGVHMLINDGQ
IHVVDSSELAFKTAVHGAFREAFVKAQPIILEPIMEVSLTAPVEFQGNILGLLNKRMATINTTDIGSDEFTITAECSLNS
MFGFASHLRAATQGKGEFSLEFKHYAPTPPQLQRELIAEFQKKQKAKK

GO term prediction

Biological Process

GO:0006414 translational elongation

Molecular Function

GO:0003746 translation elongation factor activity
GO:0003924 GTPase activity
GO:0005525 GTP binding

Cellular Component

GO:0005622 intracellular