Protein

MIA_02183_1

Length
148 amino acids


Browser: contig03:68408-68904-

Protein function

EGGNOG:0PR45RCF1Cytochrome c oxidase subunit which plays a role in assembly of respiratory supercomplexes (By similarity)
SGD closest match:S000004492RCF1Respiratory supercomplex factor 1, mitochondrial
CGD closest match:CAL0000199655RCF1Respiratory supercomplex factor 1, mitochondrial

Protein alignments

%idAln lengthE-value
MCA_06460_164.029%1392.19e-64MCA_06460_1
A0A0J9X5Y3_GEOCN62.500%1366.97e-57Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA03s04223g PE=4 SV=1
RCF1_YARLI52.273%1321.49e-39Respiratory supercomplex factor 1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RCF1 PE=3 SV=2
UniRef50_Q6CBQ852.273%1323.46e-36Respiratory supercomplex factor 1, mitochondrial n=3 Tax=Dipodascaceae TaxID=34353 RepID=RCF1_YARLI
A0A060T0N5_BLAAD45.833%1442.06e-38ARAD1C09680p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C09680g PE=4 SV=1
A0A167E6L4_9ASCO50.000%1269.54e-35Rcf1p OS=Sugiyamaella lignohabitans GN=RCF1 PE=4 SV=1
A0A1E3PEX3_9ASCO43.966%1161.72e-31Altered inheritance of mitochondria protein 31, mitochondrial (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_27744 PE=4 SV=1
RCF1_YEAST44.186%1292.11e-29Respiratory supercomplex factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCF1 PE=1 SV=1
RCF1_CANAL42.520%1273.35e-29Respiratory supercomplex factor 1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RCF1 PE=3 SV=2
A0A1E4TIN1_9ASCO38.182%1103.27e-14Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13829 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0028

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 148

Detailed signature matches

    1. PS51503 (HIG1)
    2. PF04588 (HIG_1_N)
Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_02183_1
MDLPSSADSKDLDESELGFGEKVLKNCKEQPLVPIGVGMTLGALILSARALNRGDAKTANRMFVWRVALQGLTIVALVGG
SYYVGINERWRVNRDDELRKKAEVREKMWIEELERIDTAAKERAQRAELFRAARAKQEANGVDNNEKP

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.