Protein

MCA_06460_1

Length
145 amino acids


Gene name: RCF1

Description: Respiratory supercomplex factor 1, mitochondrial; Cytochrome c oxidase subunit

Browser: contigD:4309356-4309857-

RNA-seq: read pairs 1466, FPKM 124.1, percentile rank 82.3% (100% = highest expression)

Protein function

Annotation:RCF1Respiratory supercomplex factor 1, mitochondrial; Cytochrome c oxidase subunit
EGGNOG:0PR45RCF1Cytochrome c oxidase subunit which plays a role in assembly of respiratory supercomplexes (By similarity)
SGD closest match:S000004492RCF1Respiratory supercomplex factor 1, mitochondrial
CGD closest match:CAL0000199655RCF1Respiratory supercomplex factor 1, mitochondrial

Protein alignments

%idAln lengthE-value
MIA_02183_164.03%1392e-57MIA_02183_1
A0A0J9X5Y3_GEOCN65.00%1208e-53Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA03s04223g PE=4 SV=1
A0A060T0N5_BLAAD49.15%1182e-35ARAD1C09680p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C09680g PE=4 SV=1
UniRef50_A0A060T0N549.15%1185e-32ARAD1C09680p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060T0N5_BLAAD
RCF1_YARLI50.85%1181e-33Respiratory supercomplex factor 1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RCF1 PE=3 SV=2
A0A167E6L4_9ASCO49.14%1163e-33Rcf1p OS=Sugiyamaella lignohabitans GN=RCF1 PE=4 SV=1
RCF1_YEAST47.71%1096e-31Respiratory supercomplex factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCF1 PE=1 SV=1
A0A1E3PEX3_9ASCO49.52%1057e-31Altered inheritance of mitochondria protein 31, mitochondrial (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_27744 PE=4 SV=1
RCF1_CANAL47.41%1164e-29Respiratory supercomplex factor 1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RCF1 PE=3 SV=2
A0A1E4TIN1_9ASCO38.78%981e-14Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13829 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0072

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 145

Detailed signature matches

    1. PS51503 (HIG1)
    2. PF04588 (HIG_1_N)
Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)
  2. mobidb-lite (disord...)

Protein sequence

>MCA_06460_1
MELPSSADHTTFTDDELTFSEKMIKNCKQQPLVPIGTFLTCGALALSVRASRRGNSFQANRMFVWRIVLQGLTVVALVGG
SWYLGLDEKWKKGREDELRQKAEIREKMWIEELERIDQDARERQERSRRFREAKAKMEAESKSDE

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.