Protein

MIA_02166_1

Length
65 amino acids

Browser: contig03:41408-41705+

Protein function

EGGNOG:0PRZKATP18K02142 F-type H -transporting ATPase subunit j EC 3.6.3.14
SGD closest match:S000007247ATP18ATP synthase subunit J, mitochondrial
CGD closest match:CAL0000182581ATP18F1F0 ATP synthase subunit i

Protein alignments

%idAln lengthE-value
MCA_06470_183.077%655.24e-38MCA_06470_1
A0A0J9X854_GEOCN70.769%651.36e-30Similar to Saccharomyces cerevisiae YML081C-A ATP18 Subunit of the mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA05s00070g PE=4 SV=1
Q6C8S0_YARLI56.452%621.06e-20YALI0D17490p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D17490g PE=4 SV=2
UniRef50_G3AKL252.632%572.04e-15Subunit I/j of mitochondrial ATP synthase n=23 Tax=Saccharomycetales TaxID=4892 RepID=G3AKL2_SPAPN
A0A1D8PG50_CANAL58.182%551.48e-17F1F0 ATP synthase subunit i OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP18 PE=4 SV=1
A0A1E4TA79_9ASCO61.538%521.52e-17Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_27301 PE=4 SV=1
ATP18_YEAST54.717%538.28e-17ATP synthase subunit J, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP18 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6632

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR006995
    ATP synthase, F0 complex, subunit J
    1. PF04911 (ATP-synt_J)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. NON_CYTOPLASM... (N...)
  3. TMhelix
  4. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_02166_1
MAFFSSFKKYPTPVLKPLWPFFAGAVVVTYLVSLGAKASMNSAEFINDPRHPRFIAGGKIQKEEH

GO term prediction

Biological Process

GO:0015986 ATP synthesis coupled proton transport

Molecular Function

GO:0015078 hydrogen ion transmembrane transporter activity

Cellular Component

GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)