Protein
MCA_06470_1
Length
65 amino acids
Gene name: ATP18
Description: ATP synthase subunit J, mitochondrial
Browser: contigD:4339263-4339948-
RNA-seq: read pairs 19018, FPKM 3560.4, percentile rank 98.8% (100% = highest expression)
Protein function
Annotation: | ATP18 | ATP synthase subunit J, mitochondrial | |
---|---|---|---|
KEGG: | K02142 | ATPeFJ | F-type H+-transporting ATPase subunit j |
EGGNOG: | 0PRZK | ATP18 | K02142 F-type H -transporting ATPase subunit j EC 3.6.3.14 |
SGD closest match: | S000007247 | ATP18 | ATP synthase subunit J, mitochondrial |
CGD closest match: | CAL0000182581 | ATP18 | F1F0 ATP synthase subunit i |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_02166_1 | 83.08% | 65 | 1e-36 | MIA_02166_1 |
A0A0J9X854_GEOCN | 69.23% | 65 | 2e-29 | Similar to Saccharomyces cerevisiae YML081C-A ATP18 Subunit of the mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA05s00070g PE=4 SV=1 |
Q6C8S0_YARLI | 56.45% | 62 | 1e-19 | YALI0D17490p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D17490g PE=4 SV=2 |
UniRef50_C5DFU2 | 58.49% | 53 | 6e-15 | KLTH0D17952p n=2 Tax=Lachancea TaxID=300275 RepID=C5DFU2_LACTC |
A0A1D8PG50_CANAL | 61.82% | 55 | 1e-17 | F1F0 ATP synthase subunit i OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP18 PE=4 SV=1 |
A0A1E4TA79_9ASCO | 61.54% | 52 | 8e-17 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_27301 PE=4 SV=1 |
ATP18_YEAST | 49.12% | 57 | 9e-16 | ATP synthase subunit J, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP18 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.6080
Protein family membership
- ATP synthase, F0 complex, subunit J (IPR006995)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF04911 (ATP-synt_J)
-

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_06470_1 MALFGSFKKYPTPVLKPLWPFFTGAIVITYLVGLGAKASMNSPEFINDPRNPRFVAGGKIEKTEH
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
Molecular Function
GO:0015078 hydrogen ion transmembrane transporter activity
Cellular Component
GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)