Protein

MIA_02138_1

Length
419 amino acids

Browser: contig02:2728897-2730278-

Protein function

EGGNOG:0PG6YRPT4regulatory subunit
SGD closest match:S000005785RPT426S proteasome subunit RPT4
CGD closest match:CAL0000188624RPT4Proteasome regulatory particle base subunit

Protein alignments

%idAln lengthE-value
MCA_05557_191.605%4050.0MCA_05557_1
A0A0J9X567_GEOCN90.000%4000.0Similar to Saccharomyces cerevisiae YOR259C RPT4 One of six ATPases of the 19S regulatory particle of the 26S proteasome involved in degradation of ubiquitinated substrates OS=Geotrichum candidum GN=BN980_GECA03s00384g PE=3 SV=1
A0A060TA07_BLAAD88.529%4010.0ARAD1B03960p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B03960g PE=3 SV=1
A0A1E3PPF5_9ASCO86.029%4080.0Putative 26S protease subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81750 PE=3 SV=1
Q6C516_YARLI85.500%4000.0YALI0E21868p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E21868g PE=3 SV=1
Q5A6S2_CANAL82.410%4150.0Proteasome regulatory particle base subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPT4 PE=3 SV=1
A0A1E4TA56_9ASCO83.155%3740.0Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3262 PE=3 SV=1
PRS10_YEAST74.584%4210.026S proteasome subunit RPT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT4 PE=1 SV=4
UniRef50_A0A0C9MQK378.796%3820.026S protease regulatory subunit 10B-like isoform 2 n=1 Tax=Mucor ambiguus TaxID=91626 RepID=A0A0C9MQK3_9FUNG
A0A167DYI9_9ASCO94.030%2680.0Proteasome regulatory particle base subunit RPT4 OS=Sugiyamaella lignohabitans GN=RPT4 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0103

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 419

Detailed signature matches

  1. Family IPR005937
    26S proteasome regulatory subunit P45-like
    1. TIGR01242
  2. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  3. Domain IPR003593
    AAA+ ATPase domain
    1. SM00382 (AAA_5)
  4. Domain IPR003959
    ATPase, AAA-type, core
    1. PF00004 (AAA)
  5. SITE IPR003960
    ATPase, AAA-type, conserved site
    1. PS00674 (AAA)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:1.10.8.60
  3. G3DSA:3.40.50...
  4. cd00009 (AAA)
  5. mobidb-lite (disord...)

Residue annotation

  1. Walker A motif cd0...
  2. ATP binding site c...
  3. Walker B motif cd0...
  4. arginine finger cd...

Protein sequence

>MIA_02138_1
MSAEDERDPLLAALEDDESMGASAADSTAPVDPEREKALDGFKRKLKEHREWDAKLKEMRLTIKDLDKEYEKTEDDLKAL
QSLGQIIGEVLKQLDEERFIVKSSNGPRYIVGCRNSIKKESLKQGVRVALDMTTLTIMRILPREVDPLVYNMTTFEPGSL
TFGGIGGLNEQIRELREVIELPLKNPELFQRVGINPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPASAIVDKYIGE
SARVIREMFGYAKEHAPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDYLGQTKVIMATNRPDTLDPALL
RAGRLDRKIEIPLPNEIGRLEIFKIHSANVQKQGDFDYEALVKLSDGFNGADIRNVVTEAGFFAIRDDRDYIVQNDMMKA
VRKVAEAKKLEGKLEYEKL

GO term prediction

Biological Process

GO:0030163 protein catabolic process

Molecular Function

GO:0005524 ATP binding
GO:0016787 hydrolase activity

Cellular Component

GO:0005737 cytoplasm