Protein
MIA_02133_1
Length
105 amino acids
Browser: contig02:2720246-2720864+
Protein function
EGGNOG: | 0PRWG | FG10368.1 | 60S acidic ribosomal protein P1 |
---|---|---|---|
SGD closest match: | S000002288 | RPP1B | 60S acidic ribosomal protein P1-beta |
CGD closest match: | CAL0000195487 | RPP1B | Ribosomal protein P1B |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
UniRef50_G8YFW0 | 78.689% | 61 | 3.81e-24 | Piso0_002753 protein n=2 Tax=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) TaxID=559304 RepID=G8YFW0_PICSO |
MCA_05704_1 | 75.238% | 105 | 2.20e-27 | MCA_05704_1 |
A0A060T799_BLAAD | 79.661% | 59 | 5.77e-26 | ARAD1B17974p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B17974g PE=3 SV=1 |
A0A0J9X4U3_GEOCN | 79.310% | 58 | 7.69e-25 | Similar to Saccharomyces cerevisiae YDL130W RPP1B Ribosomal stalk protein P1 beta OS=Geotrichum candidum GN=BN980_GECA02s07424g PE=3 SV=1 |
RLA3_YEAST | 71.186% | 59 | 2.88e-24 | 60S acidic ribosomal protein P1-beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPP1B PE=1 SV=3 |
A0A1D8PRG5_CANAL | 65.574% | 61 | 1.22e-23 | Ribosomal protein P1B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPP1B PE=3 SV=1 |
A0A1E3PGQ7_9ASCO | 61.905% | 105 | 1.98e-22 | Ribosomal protein 60S OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47240 PE=3 SV=1 |
Q6CEU7_YARLI | 69.492% | 59 | 5.40e-22 | YALI0B12804p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B12804g PE=3 SV=1 |
A0A1E4TFQ6_9ASCO | 58.730% | 63 | 3.30e-20 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_107738 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0740
Protein family membership
- Ribosomal protein L12 family (IPR027534)
Domains and repeats
None predicted.
Detailed signature matches
-
-
MF_01478 (Ribosomal...)
-

Unintegrated signatures
-
-
NON_CYTOPLASM... (N...)
-
PF00428 (Ribosomal_60s)
-
SIGNAL_PEPTIDE (Sig...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
cd05831 (Ribosomal_P1)
-
mobidb-lite (disord...)
Protein sequence
>MIA_02133_1 MSSEAAVSYAALILADAGSEISADNLLSLTKAAGVKVDNIWANVYAKALEGKDLKEILFAFGAAGPAAAAAPAAAAGSSD AAAAEEKAESEEEESDEDMGFGLFD
GO term prediction
Biological Process
GO:0006414 translational elongation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome