Protein
MCA_05704_1
Length
105 amino acids
Browser: contigD:2081456-2082150+
RNA-seq: read pairs 23233, FPKM 2708.2, percentile rank 98.2% (100% = highest expression)
Protein function
KEGG: | K02942 | RP-LP1 | large subunit ribosomal protein LP1 |
---|---|---|---|
EGGNOG: | 0PRWG | FG10368.1 | 60S acidic ribosomal protein P1 |
SGD closest match: | S000002239 | RPP1A | 60S acidic ribosomal protein P1-alpha |
CGD closest match: | CAL0000178222 | RPP1A | 60S acidic ribosomal protein P1-A |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XCM7_GEOCN | 69.52% | 105 | 9e-26 | Similar to Saccharomyces cerevisiae YDL081C RPP1A Ribosomal stalk protein P1 alpha OS=Geotrichum candidum GN=BN980_GECA10s02056g PE=3 SV=1 |
MIA_02133_1 | 79.31% | 58 | 9e-25 | MIA_02133_1 |
UniRef50_G8YFW0 | 74.58% | 59 | 2e-20 | Piso0_002753 protein n=2 Tax=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) TaxID=559304 RepID=G8YFW0_PICSO |
A0A1E3PGQ7_9ASCO | 59.05% | 105 | 1e-23 | Ribosomal protein 60S OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47240 PE=3 SV=1 |
A0A060T799_BLAAD | 73.68% | 57 | 5e-23 | ARAD1B17974p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B17974g PE=3 SV=1 |
RLA1_CANAL | 64.15% | 106 | 1e-22 | 60S acidic ribosomal protein P1-A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPP1A PE=3 SV=1 |
RLA1_YEAST | 58.49% | 106 | 6e-22 | 60S acidic ribosomal protein P1-alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPP1A PE=1 SV=4 |
Q6CEU7_YARLI | 67.80% | 59 | 2e-21 | YALI0B12804p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B12804g PE=3 SV=1 |
A0A1E4TFQ6_9ASCO | 57.80% | 109 | 4e-17 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_107738 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0713
Protein family membership
- Ribosomal protein L12 family (IPR027534)
Domains and repeats
None predicted.
Detailed signature matches
-
-
MF_01478 (Ribosomal...)
-
![Unintegrated signatures Unintegrated signatures](resources/images/ico_type_uni_small.png)
Unintegrated signatures
-
PF00428 (Ribosomal_60s)
-
cd05831 (Ribosomal_P1)
-
mobidb-lite (disord...)
Protein sequence
>MCA_05704_1 MSAEAAISYAALILADSEVELSSDNLLALTKAANVKVDSIWANIYAKALEGKDLKETLFAFGAAGSAAAAAPAGGAAAAA DAPAEEEKEEEQEESDDDMGFGLFD
GO term prediction
Biological Process
GO:0006414 translational elongation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome