Protein

MIA_02039_1

Length
321 amino acids


Browser: contig02:2441080-2442046-

Protein function

EGGNOG:0PF9QTRR1thioredoxin reductase
SGD closest match:S000002761TRR1Thioredoxin reductase 1
CGD closest match:CAL0000184081TRR1Thioredoxin reductase

Protein alignments

%idAln lengthE-value
MCA_04576_185.981%3210.0MCA_04576_1
A0A060T8J5_BLAAD83.750%3200.0Thioredoxin reductase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D04026g PE=3 SV=1
TRXB_YARLI82.390%3180.0Thioredoxin reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRR1 PE=3 SV=1
A0A0J9X5D2_GEOCN81.703%3170.0Thioredoxin reductase OS=Geotrichum candidum GN=BN980_GECA03s00725g PE=3 SV=1
A0A167EQJ0_9ASCO79.560%3180.0Thioredoxin reductase OS=Sugiyamaella lignohabitans GN=TRR1 PE=3 SV=1
A0A1E3PRC8_9ASCO77.918%3170.0Thioredoxin reductase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45593 PE=3 SV=1
Q5AG89_CANAL77.673%3180.0Thioredoxin reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRR1 PE=3 SV=1
A0A1E4TC90_9ASCO77.429%3190.0Thioredoxin reductase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_138952 PE=3 SV=1
TRXB1_YEAST78.165%3160.0Thioredoxin reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRR1 PE=1 SV=3
UniRef50_Q6FR3977.287%3170.0Thioredoxin reductase n=414 Tax=root TaxID=1 RepID=TRXB_CANGA

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1890

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 321

Detailed signature matches

    1. PR00469 (PNDRDTASEII)
    1. PF07992 (Pyr_redox_2)
    2. SSF51905 (FAD/NAD(P...)
    1. PS00573 (PYRIDINE_R...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PR00368 (FADPNR)

Protein sequence

>MIA_02039_1
MSHHRVVIIGSGPAAHTAAIYLARAEIKPTLFEGMLANGIAAGGQLTTTTEIENFPGFPEGITGSGLMDNMRKQSERFGT
EIITETVAKVDLSQRPFKFWTEYNESEPPQTADAIILATGASARRMNLPGEDTYWQAGISACAVCDGAVPIFRNKPLAVI
GGGDSAAEEAIFLTKYGSKVFVLVRKDKLRASTIMQKRLLSHPKVEVLFNTEATEACGDGKLLQSLSIFNNKTGEKKSLE
VNGLFYAIGHIPATQIVQGQVDTDPEGYIKTIPGSALTSVKGVFAAGDVQDKRYRQAITSAGTGCMAALDCEKFLTEEGE
L

GO term prediction

Biological Process

GO:0019430 removal of superoxide radicals
GO:0055114 oxidation-reduction process

Molecular Function

GO:0004791 thioredoxin-disulfide reductase activity
GO:0016491 oxidoreductase activity

Cellular Component

GO:0005737 cytoplasm