Protein

MCA_04576_1

Length
323 amino acids

Gene name: TRR1

Description: Thioredoxin reductase

Browser: contigC:3421807-3422779-

RNA-seq: read pairs 42188, FPKM 1608.9, percentile rank 97.5% (100% = highest expression)

Protein function

Annotation:TRR1Thioredoxin reductase
KEGG:K00384trxB thioredoxin reductase (NADPH) [EC:1.8.1.9]
EGGNOG:0PF9QTRR1thioredoxin reductase
SGD closest match:S000002761TRR1Thioredoxin reductase 1
CGD closest match:CAL0000184081TRR1Thioredoxin reductase

Protein alignments

%idAln lengthE-value
MIA_02039_185.98%3210.0MIA_02039_1
A0A060T8J5_BLAAD82.24%3210.0Thioredoxin reductase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D04026g PE=3 SV=1
A0A0J9X5D2_GEOCN81.06%3222e-180Thioredoxin reductase OS=Geotrichum candidum GN=BN980_GECA03s00725g PE=3 SV=1
Q5AG89_CANAL80.19%3232e-177Thioredoxin reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRR1 PE=3 SV=1
A0A167EQJ0_9ASCO78.88%3222e-177Thioredoxin reductase OS=Sugiyamaella lignohabitans GN=TRR1 PE=3 SV=1
TRXB_YARLI78.26%3225e-173Thioredoxin reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRR1 PE=3 SV=1
TRXB1_YEAST79.25%3186e-169Thioredoxin reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRR1 PE=1 SV=3
UniRef50_P2950979.25%3182e-165Thioredoxin reductase 1 n=127 Tax=Eukaryota TaxID=2759 RepID=TRXB1_YEAST
A0A1E3PRC8_9ASCO74.22%3224e-166Thioredoxin reductase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45593 PE=3 SV=1
A0A1E4TC90_9ASCO74.61%3197e-163Thioredoxin reductase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_138952 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1248

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 323

Detailed signature matches

  1. Family IPR000103
    Pyridine nucleotide-disulphide oxidoreductase, class-II
    1. PR00469 (PNDRDTASEII)
  2. Family IPR005982
    Thioredoxin reductase
    1. TIGR01292
  3. Domain IPR023753
    FAD/NAD(P)-binding domain
    1. PF07992 (Pyr_redox_2)
    2. G3DSA:3.50.50.60
    3. SSF51905 (FAD/NAD(P...)
  4. SITE IPR008255
    Pyridine nucleotide-disulphide oxidoreductase, class-II, active site
    1. PS00573 (PYRIDINE_R...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.50...
  2. PR00368 (FADPNR)

Protein sequence

>MCA_04576_1
MSHHKVVIIGSGPAAHTAAIYLARAEIKPTLFEGLLANGIAAGGQLTTTTDIENFPGFPEGISGSELMENMRKQSERFGT
EIITETISKVDLSKRPFKLWTEWSDENDESAAHTADAIIIATGASARRMHLPGEETYWQQGISACAVCDGAVPIFRNQPL
AVIGGGDSAAEEAIFLTKYGSKVFVLVRKDKLRASTIMQKRLLNHPKVEVLFNTEAVEAAGDGKLLNKLVIKNNKTNEQK
DLEVKGLFYAIGHIPATKIVQNQVDTDEDGYIKTVPGSSLTSVKGVFAAGDVQDKKYRQAITSAGSGCMAALDCEKFLGE
EEA

GO term prediction

Biological Process

GO:0019430 removal of superoxide radicals
GO:0055114 oxidation-reduction process

Molecular Function

GO:0004791 thioredoxin-disulfide reductase activity
GO:0016491 oxidoreductase activity

Cellular Component

GO:0005737 cytoplasm