Protein

MIA_02006_1

Length
151 amino acids


Browser: contig02:2332227-2332845-

Protein function

EGGNOG:0PMVCRPS1340s ribosomal protein s13
SGD closest match:S000002471RPS1340S ribosomal protein S13
CGD closest match:CAL0000187390RPS13Ribosomal 40S subunit protein S13

Protein alignments

%idAln lengthE-value
MCA_02501_188.079%1519.23e-101MCA_02501_1
Q6C242_YARLI88.079%1513.90e-100YALI0F11055p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F11055g PE=3 SV=1
A0A0J9XC78_GEOCN89.404%1511.05e-99Similar to Saccharomyces cerevisiae YDR064W RPS13 Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA08s04971g PE=3 SV=1
A0A1D8PPE0_CANAL84.667%1506.85e-95Ribosomal 40S subunit protein S13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS13 PE=3 SV=1
RS13_YEAST81.457%1517.51e-9540S ribosomal protein S13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS13 PE=1 SV=3
UniRef50_P0575681.457%1511.80e-9140S ribosomal protein S13 n=616 Tax=Eukaryota TaxID=2759 RepID=RS13_YEAST
A0A1E3PR93_9ASCO82.119%1511.49e-93Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_39191 PE=3 SV=1
A0A060SZ08_BLAAD81.333%1501.54e-89ARAD1C04950p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C04950g PE=3 SV=1
A0A1E4TE13_9ASCO72.727%1432.28e-77Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31047 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8331
Predicted cleavage: 23

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 151

Detailed signature matches

    1. SM01387 (Ribosomal_...)
    2. cd00353 (Ribosomal_...)
    3. PF00312 (Ribosomal_S15)
    4. PS00362 (RIBOSOMAL_S15)
    1. MF_01343_A (Ribosom...)
    1. SM01386 (Ribosomal_...)
    2. PF08069 (Ribosomal_...)
    1. SSF47060 (S15/NS1 R...)
Unintegrated signatures no IPR
Unintegrated signatures

Residue annotation

  1. 16S/18S rRNA bindi...
  2. S13e-L30e interact...
  3. 25S rRNA binding s...

Protein sequence

>MIA_02006_1
MGRLHSKGKGISASAIPYSRRAPSWFKLTPESVVEQIIKYARKGLTPSQIGVILRDSHGVSQVRVVTGNKILRILRANGL
APEIPEDLYHLIKKAVAIRKHLEKNRKDKDSKFRLILVESRIHRLSRYYKTVGVLAPTWKYESATASALVN

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome