Protein

MCA_02501_1

Length
151 amino acids

Gene name: RPS13

Description: 40S ribosomal protein S13

Browser: contigB:1488941-1489820-

RNA-seq: read pairs 30811, FPKM 2504.6, percentile rank 98.1% (100% = highest expression)

Protein function

Annotation:RPS1340S ribosomal protein S13
KEGG:K02953RP-S13e small subunit ribosomal protein S13e
EGGNOG:0PMVCRPS1340s ribosomal protein s13
SGD closest match:S000002471RPS1340S ribosomal protein S13
CGD closest match:CAL0000187390RPS13Ribosomal 40S subunit protein S13

Protein alignments

%idAln lengthE-value
Q6C242_YARLI89.40%1511e-100YALI0F11055p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F11055g PE=3 SV=1
MIA_02006_188.08%1514e-99MIA_02006_1
A0A0J9XC78_GEOCN86.75%1514e-97Similar to Saccharomyces cerevisiae YDR064W RPS13 Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA08s04971g PE=3 SV=1
A0A1E3PR93_9ASCO84.77%1512e-94Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_39191 PE=3 SV=1
RS13_YEAST82.12%1515e-9440S ribosomal protein S13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS13 PE=1 SV=3
UniRef50_P0575682.12%1511e-9040S ribosomal protein S13 n=616 Tax=Eukaryota TaxID=2759 RepID=RS13_YEAST
A0A1D8PPE0_CANAL84.67%1506e-94Ribosomal 40S subunit protein S13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS13 PE=3 SV=1
A0A060SZ08_BLAAD80.00%1502e-88ARAD1C04950p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C04950g PE=3 SV=1
A0A1E4TE13_9ASCO76.92%1434e-81Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31047 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8192
Predicted cleavage: 23

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 151

Detailed signature matches

  1. Family IPR000589
    Ribosomal protein S15
    1. SM01387 (Ribosomal_...)
    2. cd00353 (Ribosomal_...)
    3. PF00312 (Ribosomal_S15)
    4. PS00362 (RIBOSOMAL_S15)
  2. Family IPR023029
    Ribosomal protein S15P
    1. MF_01343_A (Ribosom...)
  3. Domain IPR012606
    Ribosomal protein S13/S15, N-terminal
    1. SM01386 (Ribosomal_...)
    2. PF08069 (Ribosomal_...)
  4. Domain IPR009068
    S15/NS1, RNA-binding
    1. SSF47060 (S15/NS1 R...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.10.28...

Residue annotation

  1. 16S/18S rRNA bindi...
  2. S13e-L30e interact...
  3. 25S rRNA binding s...

Protein sequence

>MCA_02501_1
MGRMHSKGKGMSASAIPYSRRSPAWFKLTPESVVEQIIKYARKGLSPSQIGVILRDSHGVSQVKIATGNKILRILKSNGI
APEIPEDLYHLIKKAVSIRKHLEKNRKDKDSKFRLVLIESRIHRLARYYRTTGVLPPTWKYESATASALVN

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome