Protein
MIA_01986_1
Length
158 amino acids
Browser: contig02:2278427-2278968+
Protein function
| EGGNOG: | 0PR5T | exosome-associated family | |
|---|---|---|---|
| CGD closest match: | CAL0000186441 | orf19.5067 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_05271_1 | 47.973% | 148 | 2.59e-31 | MCA_05271_1 |
| A0A0J9X908_GEOCN | 47.107% | 121 | 1.34e-24 | Similar to Saccharomyces cerevisiae YHR081W LRP1 Nuclear exosome-associated nucleic acid binding protein OS=Geotrichum candidum GN=BN980_GECA04s07204g PE=4 SV=1 |
| UniRef50_A0A0J9X908 | 47.107% | 121 | 2.73e-21 | Similar to Saccharomyces cerevisiae YHR081W LRP1 Nuclear exosome-associated nucleic acid binding protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X908_GEOCN |
| A0A1E3PTC6_9ASCO | 45.349% | 86 | 4.55e-17 | C1D-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81157 PE=4 SV=1 |
| A0A060T3A7_BLAAD | 38.211% | 123 | 1.04e-16 | ARAD1C39116p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C39116g PE=4 SV=1 |
| Q6C2H9_YARLI | 40.741% | 54 | 2.39e-10 | YALI0F07755p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F07755g PE=4 SV=1 |
| A0A1D8PE95_CANAL | 44.898% | 49 | 1.86e-08 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5067 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0524
Protein family membership
- Sas10/Utp3/C1D (IPR007146)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF04000 (Sas10_Utp3)
-
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_01986_1 MESVPNVQKTVDALGAQIDSLKPLLEDLLTEDVEDLSPLDQANHYAAITYALDAIIFAYLKSVGADPKNHPISAELQRVK ATMARLAAAKSPTPGQGGAAATASRAPRIDKEAAARFVKHSLGSGSSASAPSKSSNEATEFLKQMSQSIASQKKKTKQ
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.