Protein

MIA_01960_1

Length
312 amino acids

Browser: contig02:2198204-2199223+

Protein function

EGGNOG:0PI50HIS1ATP phosphoribosyltransferase
SGD closest match:S000000857HIS1ATP phosphoribosyltransferase
CGD closest match:CAL0000180598HIS1ATP phosphoribosyltransferase

Protein alignments

%idAln lengthE-value
MCA_05234_180.449%3120.0MCA_05234_1
A0A0J9XAP9_GEOCN70.607%3131.93e-156Similar to Saccharomyces cerevisiae YER055C HIS1 ATP phosphoribosyltransferase OS=Geotrichum candidum GN=BN980_GECA07s01352g PE=3 SV=1
A0A060TG19_BLAAD69.329%3139.77e-151ARAD1D27500p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D27500g PE=3 SV=1
A0A1E3PCP4_9ASCO66.026%3129.83e-146ATP phosphoribosyltransferase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84551 PE=3 SV=1
HIS1_YARLI66.026%3121.02e-145ATP phosphoribosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HIS1 PE=3 SV=1
UniRef50_Q9914566.026%3122.36e-142ATP phosphoribosyltransferase n=47 Tax=Fungi TaxID=4751 RepID=HIS1_YARLI
HIS1_YEAST61.859%3123.60e-137ATP phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS1 PE=1 SV=1
A0A1E4TDI7_9ASCO62.154%3251.61e-134Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4441 PE=3 SV=1
HIS1_CANAL60.188%3192.17e-128ATP phosphoribosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HIS1 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0598

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 312

Detailed signature matches

  1. Family IPR020621
    ATP phosphoribosyltransferase HisG, long form
    1. MF_00079 (HisG_Long)
  2. Domain IPR013820
    ATP phosphoribosyltransferase, catalytic domain
    1. TIGR00070
    2. PF01634 (HisG)
  3. Domain IPR015867
    Nitrogen regulatory protein PII/ATP phosphoribosyltransferase, C-terminal
    1. G3DSA:3.30.70...
  4. Domain IPR011322
    Nitrogen regulatory PII-like, alpha/beta
    1. SSF54913 (GlnB-like)
  5. Domain IPR013115
    Histidine biosynthesis HisG, C-terminal
    1. TIGR03455
    2. PF08029 (HisG_C)
  6. SITE IPR018198
    ATP phosphoribosyltransferase, conserved site
    1. PS01316 (ATP_P_PHOR...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.19...
  2. SSF53850 (Periplasm...)

Protein sequence

>MIA_01960_1
MDLVNHLTDRLLFAVPKKGRLNERAIQLLNGADIQFKRSHRLDIALSTNMPVALVFLPAADIPRFVAEGKCALGITGYDQ
VCESGMDCDMLLDLSFGKCKLQVQVPEAGEFADPKQLIGKSIVTSFTKLTTEFFAKLEAEQAAGTSIPDGDDRISTSNLK
TTIKYVGGSVEAAVALGVADAIVDLVESGETMRAAGLKPIGTLLNTSAWLLQSKHASQEDLDRVKIIRSRIEGVLAASRY
VLCNYNAPRSNLPELLKITPGRRAPTITQLEEDNWVAVSSMVLQTEIAAVMDKLEANGAEDILVFNISNCRV

GO term prediction

Biological Process

GO:0000105 histidine biosynthetic process

Molecular Function

GO:0000287 magnesium ion binding
GO:0003879 ATP phosphoribosyltransferase activity

Cellular Component

GO:0005737 cytoplasm