Protein

MIA_01959_1

Length
89 amino acids

Browser: contig02:2196648-2197111-

Protein function

EGGNOG:0PQTHRPS28A40s ribosomal protein s28
SGD closest match:S000004254RPS28B40S ribosomal protein S28-B
CGD closest match:CAL0000196464RPS28BRibosomal 40S subunit protein S28B

Protein alignments

%idAln lengthE-value
A0A060TAJ2_BLAAD95.522%672.15e-41ARAD1D27478p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D27478g PE=3 SV=1
A0A0J9XAM7_GEOCN95.522%671.93e-41Similar to Saccharomyces cerevisiae YLR264W RPS28B Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA07s01341g PE=3 SV=1
UniRef50_A5DAU990.000%706.38e-3740S ribosomal protein S28-A n=7 Tax=Opisthokonta TaxID=33154 RepID=A5DAU9_PICGU
MCA_05235_291.045%671.18e-39MCA_05235_2
A0A1D8PQN0_CANAL89.552%673.85e-39Ribosomal 40S subunit protein S28B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS28B PE=3 SV=1
A0A1E4TLS8_9ASCO86.567%672.71e-39Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_21669 PE=3 SV=1
RS28B_YEAST89.552%672.09e-3840S ribosomal protein S28-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS28B PE=1 SV=1
A0A1E3PCH4_9ASCO86.567%673.30e-38Ribosomal protein S28e OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48289 PE=3 SV=1
Q6CCZ9_YARLI92.063%631.54e-37YALI0C05148p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C05148g PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3547

Protein family membership

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 80 89

Detailed signature matches

  1. Family IPR000289
    Ribosomal protein S28e
    1. cd04457 (S1_S28E)
    2. MF_00292 (Ribosomal...)
    3. PF01200 (Ribosomal_...)
    4. PD005541
  2. Domain IPR012340
    Nucleic acid-binding, OB-fold
    1. SSF50249 (Nucleic a...)
  3. SITE IPR028626
    Ribosomal protein S28e conserved site
    1. PS00961 (RIBOSOMAL_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:2.40.50...

Residue annotation

  1. RNA binding site c...

Protein sequence

>MIA_01959_1
MVRFSLGTVYPSYPALDKFLKSLDTKTPVKLAKVIKVLGRTGSRGGVTQVRVEFIDDTSRTIVRNVKGPVREDDILCLME
SEREARRLR

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome