Protein
MIA_01956_1
Length
123 amino acids
Browser: contig02:2189501-2189974-
Protein function
EGGNOG: | 0PPQN | RPL34 | 60S ribosomal protein L34 |
---|---|---|---|
SGD closest match: | S000001314 | RPL34B | 60S ribosomal protein L34-B |
CGD closest match: | CAL0000185373 | orf19.6220.4 | Ribosomal 60S subunit protein L34B |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_04630_1 | 86.022% | 93 | 3.77e-56 | MCA_04630_1 |
A0A0J9XF96_GEOCN | 75.269% | 93 | 4.80e-49 | Similar to Saccharomyces cerevisiae YER056C-A RPL34A Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA13s01165g PE=4 SV=1 |
A0A060TG12_BLAAD | 70.968% | 93 | 1.46e-48 | ARAD1D27390p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D27390g PE=4 SV=1 |
Q6CD02_YARLI | 73.118% | 93 | 9.35e-47 | YALI0C05082p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C05082g PE=4 SV=2 |
RL34B_YEAST | 69.892% | 93 | 3.82e-45 | 60S ribosomal protein L34-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL34B PE=1 SV=1 |
UniRef50_P87262 | 68.817% | 93 | 1.37e-41 | 60S ribosomal protein L34-A n=118 Tax=Eukaryota TaxID=2759 RepID=RL34A_YEAST |
A0A1E3PDV9_9ASCO | 67.742% | 93 | 3.17e-44 | Ribosomal protein L34 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53714 PE=4 SV=1 |
A0A1D8PDZ1_CANAL | 67.742% | 93 | 6.99e-44 | Ribosomal 60S subunit protein L34B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6220.4 PE=4 SV=1 |
A0A1E4TBN3_9ASCO | 65.591% | 93 | 6.15e-42 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_45594 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.7718
Predicted cleavage: 63
Protein family membership
- Ribosomal protein L34Ae (IPR008195)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS01145 (RIBOSOMAL_...)
-

Unintegrated signatures
Protein sequence
>MIA_01956_1 MVQRLTYRRSNPYNTRSNKVKIVKTPGGNLRYLHLKKNPTRPKCGECAIALPGLAALRPREYSRVNNTKKTVNRAYGGSL CANCVKEKIVRAFLVEEQKVVKQVLKENAEKAKSEKKTKKARK
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome