Protein

MIA_01956_1

Length
123 amino acids

Browser: contig02:2189501-2189974-

Protein function

EGGNOG:0PPQNRPL3460S ribosomal protein L34
SGD closest match:S000001314RPL34B60S ribosomal protein L34-B
CGD closest match:CAL0000185373orf19.6220.4Ribosomal 60S subunit protein L34B

Protein alignments

%idAln lengthE-value
MCA_04630_186.022%933.77e-56MCA_04630_1
A0A0J9XF96_GEOCN75.269%934.80e-49Similar to Saccharomyces cerevisiae YER056C-A RPL34A Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA13s01165g PE=4 SV=1
A0A060TG12_BLAAD70.968%931.46e-48ARAD1D27390p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D27390g PE=4 SV=1
Q6CD02_YARLI73.118%939.35e-47YALI0C05082p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C05082g PE=4 SV=2
RL34B_YEAST69.892%933.82e-4560S ribosomal protein L34-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL34B PE=1 SV=1
UniRef50_P8726268.817%931.37e-4160S ribosomal protein L34-A n=118 Tax=Eukaryota TaxID=2759 RepID=RL34A_YEAST
A0A1E3PDV9_9ASCO67.742%933.17e-44Ribosomal protein L34 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53714 PE=4 SV=1
A0A1D8PDZ1_CANAL67.742%936.99e-44Ribosomal 60S subunit protein L34B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6220.4 PE=4 SV=1
A0A1E4TBN3_9ASCO65.591%936.15e-42Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_45594 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.7718
Predicted cleavage: 63

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR008195
    Ribosomal protein L34Ae
    1. PR01250 (RIBOSOMALL34)
    2. PF01199 (Ribosomal_...)
  2. SITE IPR018065
    Ribosomal protein L34e, conserved site
    1. PS01145 (RIBOSOMAL_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil

Protein sequence

>MIA_01956_1
MVQRLTYRRSNPYNTRSNKVKIVKTPGGNLRYLHLKKNPTRPKCGECAIALPGLAALRPREYSRVNNTKKTVNRAYGGSL
CANCVKEKIVRAFLVEEQKVVKQVLKENAEKAKSEKKTKKARK

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome