Protein
MCA_04630_1
Length
123 amino acids
Browser: contigC:3558386-3559142-
RNA-seq: read pairs 35847, FPKM 3572.0, percentile rank 98.8% (100% = highest expression)
Protein function
KEGG: | K02915 | RP-L34e | large subunit ribosomal protein L34e |
---|---|---|---|
EGGNOG: | 0PPQN | RPL34 | 60S ribosomal protein L34 |
SGD closest match: | S000002135 | RPL34A | 60S ribosomal protein L34-A |
CGD closest match: | CAL0000185373 | orf19.6220.4 | Ribosomal 60S subunit protein L34B |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_01956_1 | 86.32% | 95 | 7e-56 | MIA_01956_1 |
A0A0J9XF96_GEOCN | 76.84% | 95 | 2e-50 | Similar to Saccharomyces cerevisiae YER056C-A RPL34A Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA13s01165g PE=4 SV=1 |
UniRef50_A0A1E4T8I2 | 74.74% | 95 | 4e-47 | Uncharacterized protein n=186 Tax=Eukaryota TaxID=2759 RepID=A0A1E4T8I2_9ASCO |
RL34A_YEAST | 74.74% | 95 | 5e-50 | 60S ribosomal protein L34-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL34A PE=1 SV=1 |
A0A1D8PDZ1_CANAL | 73.68% | 95 | 5e-49 | Ribosomal 60S subunit protein L34B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6220.4 PE=4 SV=1 |
Q6CD02_YARLI | 70.53% | 95 | 2e-46 | YALI0C05082p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C05082g PE=4 SV=2 |
A0A060TG12_BLAAD | 66.32% | 95 | 6e-46 | ARAD1D27390p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D27390g PE=4 SV=1 |
A0A1E4TBN3_9ASCO | 68.42% | 95 | 5e-44 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_45594 PE=4 SV=1 |
A0A1E3PDV9_9ASCO | 66.32% | 95 | 1e-43 | Ribosomal protein L34 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53714 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.7776
Predicted cleavage: 63
Protein family membership
- Ribosomal protein L34Ae (IPR008195)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS01145 (RIBOSOMAL_...)
-

Unintegrated signatures
Protein sequence
>MCA_04630_1 MVQRLTYRRQNPYNTRSNKVKIVKTPGGKLKYQHLKKVATRPKCGDCGIALPGVSALRPREYSHVSNTKKTVNRAYGGSL CANCVKEKIIRAFLVEEQKVVKQVEKKQAEKAKSEKSKKKSKK
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome