Protein
MIA_01913_1
Length
450 amino acids
Browser: contig02:2056409-2057762-
Protein function
| EGGNOG: | 0PH6D | PGUG_00255 | Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis the synthesis of acetylglutamate from glutamate and acetyl-CoA, and of ornithine by transacetylation between acetylornithine and glutamate (By similarity) |
|---|---|---|---|
| SGD closest match: | S000004666 | ARG7 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial |
| CGD closest match: | CAL0000177240 | ECM42 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02554_1 | 82.110% | 436 | 0.0 | MCA_02554_1 |
| A0A0J9X3T5_GEOCN | 77.376% | 442 | 0.0 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Geotrichum candidum GN=BN980_GECA02s00604g PE=3 SV=1 |
| A0A161HGT5_9ASCO | 70.023% | 437 | 0.0 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Sugiyamaella lignohabitans GN=ARG7 PE=3 SV=1 |
| ARGJ_YARLI | 63.864% | 440 | 0.0 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E13057g PE=3 SV=1 |
| A0A1E3PKI2_9ASCO | 65.402% | 448 | 0.0 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51206 PE=3 SV=1 |
| A0A060T1A3_BLAAD | 66.268% | 418 | 0.0 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C18590g PE=3 SV=1 |
| A0A1E4TKL9_9ASCO | 62.945% | 421 | 0.0 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_23508 PE=3 SV=1 |
| ARGJ_CANAL | 63.551% | 428 | 0.0 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ECM42 PE=3 SV=1 |
| UniRef50_A0A0F8BSE3 | 58.057% | 453 | 1.63e-173 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial n=2 Tax=leotiomyceta TaxID=716546 RepID=A0A0F8BSE3_CERFI |
| ARGJ_YEAST | 55.581% | 430 | 1.63e-157 | Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG7 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9850
Predicted cleavage: 48
Protein family membership
- Arginine biosynthesis protein ArgJ (IPR002813)
Domains and repeats
-
Domain
1
50
100
150
200
250
300
350
400
450
450
Detailed signature matches
-
-
-
SSF56266 (DmpA/ArgJ...)
-
no IPR
Unintegrated signatures
Residue annotation
-
heterotetramer int...
-
active site pocket...
-
cleavage site cd02...
Protein sequence
>MIA_01913_1 MLSSSFKQASRALQATRFFSSSSARLTAPDKSRFVPKSGVYPKGFRVGGYYSGVKKRPELLDLAAIVSDIPAAASAVFTT NVFRAAPVQISKKVLDETHGEGINAIIINSGCANAVTGEGGLQDATTMVQLVDKTLEKPAPSGIIAKSLVMSTGVIGQHL KMDKIEAGIPELLTKHLGSDHESWLRGAKAICTTDTFPKLVSKEFSIGSNTYRIAGLAKGAGMIHPNMATLLGFFVTDAA VEPAALKSILKYAADRSFNSISVDGDTSTNDTIAALANGAAGGPVITEGSEGYQILRDAITSFAISLAQLVVRDGEGATK FITIKIEDAKTFEDAKKVASTIATSPLVKTAMFGKDANWGRILCATGYAGVEVDPAKTNVSFIPNDGSAELKLLVNGEPE NVDEARASQLLDEEDVNIRVSLGTGGGHSTEYWTCDFSHEYVTINGDYRT
GO term prediction
Biological Process
GO:0006526 arginine biosynthetic process
Molecular Function
GO:0004358 glutamate N-acetyltransferase activity
Cellular Component
None predicted.