Protein

MCA_02554_1

Length
446 amino acids


Gene name: ARG7

Description: Arginine biosynthesis bifunctional protein ArgJ, mitochondrial

Browser: contigB:1633886-1635227-

RNA-seq: read pairs 1616, FPKM 44.7, percentile rank 62.8% (100% = highest expression)

Protein function

Annotation:ARG7Arginine biosynthesis bifunctional protein ArgJ, mitochondrial
KEGG:K00620argJ glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
EGGNOG:0PH6DPGUG_00255Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis the synthesis of acetylglutamate from glutamate and acetyl-CoA, and of ornithine by transacetylation between acetylornithine and glutamate (By similarity)
SGD closest match:S000004666ARG7Arginine biosynthesis bifunctional protein ArgJ, mitochondrial
CGD closest match:CAL0000177240ECM42Arginine biosynthesis bifunctional protein ArgJ, mitochondrial

Protein alignments

%idAln lengthE-value
MIA_01913_182.11%4360.0MIA_01913_1
A0A0J9X3T5_GEOCN75.74%4410.0Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Geotrichum candidum GN=BN980_GECA02s00604g PE=3 SV=1
A0A161HGT5_9ASCO70.05%4340.0Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Sugiyamaella lignohabitans GN=ARG7 PE=3 SV=1
A0A1E3PKI2_9ASCO69.20%4350.0Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51206 PE=3 SV=1
ARGJ_YARLI65.45%4370.0Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E13057g PE=3 SV=1
A0A060T1A3_BLAAD65.39%4190.0Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C18590g PE=3 SV=1
A0A1E4TKL9_9ASCO62.32%4220.0Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_23508 PE=3 SV=1
ARGJ_CANAL61.87%4383e-180Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ECM42 PE=3 SV=1
UniRef50_A6S14659.50%4371e-170Arginine biosynthesis bifunctional protein ArgJ 1, mitochondrial n=14 Tax=sordariomyceta TaxID=715989 RepID=ARGJ1_BOTFB
ARGJ_YEAST55.71%4382e-160Arginine biosynthesis bifunctional protein ArgJ, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG7 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9952
Predicted cleavage: 30

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 400 446

Detailed signature matches

    1. MF_01106 (ArgJ)
    2. PF01960 (ArgJ)
    3. cd02152 (OAT)
    1. SSF56266 (DmpA/ArgJ...)
Unintegrated signatures no IPR
Unintegrated signatures

Residue annotation

  1. heterotetramer int...
  2. active site pocket...
  3. cleavage site cd02...

Protein sequence

>MCA_02554_1
MLKKFASVKTLTRQFSTSIRCQALDKSRFVPTSGTYPKGFKVGGYYSGVKKDPKLLDLAAIVSDPPASSSAVFTTNVFKA
APVQVSKKILEQLNGKGINGIVINSGCANAVTGEGGIKDAKTMAKIVDETLGKTPSNPEAIGATLVMSTGVIGQRLNMEK
ISAGIPVLLKEHLGSDHEAWLSAAKAICTTDTFPKMVSKEFTIGSNTYRIAGLAKGAGMIHPNMATLLGFFVTDAAVEAE
ALKSILTYANERSFNSISVDGDTSTNDTVAALANGAAGGPVITEGSEGYTILRDVITDFAISLAKLVVRDGEGATKFITI
KVEDAKTFEDAKQVASTIATSPLVKTAIYGKDANWGRILCATGYSGVPVEPSKTNVSFIPNDGSEPLKLLVNGEPENVDE
ARASQLLDEEDVNILVTLGTGGGQSTEFWTCDFSHEYVTINGDYRT

GO term prediction

Biological Process

GO:0006526 arginine biosynthetic process

Molecular Function

GO:0004358 glutamate N-acetyltransferase activity

Cellular Component

None predicted.