Protein
MIA_01912_1
Length
107 amino acids
Browser: contig02:2055876-2056306+
Protein function
| EGGNOG: | 0PQIT | FG01094.1 | Histone acetyltransferase subunit NuA4 |
|---|---|---|---|
| SGD closest match: | S000003842 | EAF6 | Chromatin modification-related protein EAF6 |
| CGD closest match: | CAL0000192577 | EAF6 | Chromatin modification-related protein EAF6 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02553_1 | 70.093% | 107 | 2.45e-55 | MCA_02553_1 |
| A0A0J9XCC6_GEOCN | 63.636% | 110 | 5.51e-50 | Similar to Saccharomyces cerevisiae YJR082C EAF6 Subunit of the NuA4 acetyltransferase complex OS=Geotrichum candidum GN=BN980_GECA10s01033g PE=4 SV=1 |
| A0A060T764_BLAAD | 56.566% | 99 | 2.21e-37 | ARAD1C18568p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C18568g PE=4 SV=1 |
| UniRef50_A0A060T764 | 56.566% | 99 | 5.46e-34 | ARAD1C18568p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060T764_BLAAD |
| A0A1E3PH95_9ASCO | 51.351% | 111 | 2.35e-31 | NuA4-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47368 PE=4 SV=1 |
| EAF6_YARLI | 55.172% | 87 | 2.01e-31 | Chromatin modification-related protein EAF6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EAF6 PE=3 SV=1 |
| A0A1E4THJ6_9ASCO | 43.956% | 91 | 1.02e-23 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_69234 PE=4 SV=1 |
| EAF6_CANAL | 42.222% | 90 | 4.64e-15 | Chromatin modification-related protein EAF6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EAF6 PE=3 SV=1 |
| EAF6_YEAST | 25.000% | 100 | 5.70e-11 | Chromatin modification-related protein EAF6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EAF6 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0042
Protein family membership
- Chromatin modification-related protein Eaf6 (IPR015418)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MIA_01912_1 MPAYTEQPTSHEVNVEEYDKVRSKLRELITKKRALDKNLNALEEQIYKAEGVYLEDTTAGNVVKGFDNYIKGSQTKKKTG LNEQDRIFSMSSAIFIKVKMKEDDDKN
GO term prediction
Biological Process
GO:0016573 histone acetylation
Molecular Function
None predicted.
Cellular Component
GO:0000123 histone acetyltransferase complex