Protein
MCA_02553_1
Length
107 amino acids
Gene name: EAF6
Description: Chromatin modification-related protein EAF6
Browser: contigB:1633368-1633752+
RNA-seq: read pairs 1074, FPKM 122.9, percentile rank 82.2% (100% = highest expression)
Protein function
| Annotation: | EAF6 | Chromatin modification-related protein EAF6 | |
|---|---|---|---|
| KEGG: | K11344 | EAF6 | chromatin modification-related protein EAF6 |
| EGGNOG: | 0Q0Z5 | Histone acetyltransferase subunit NuA4 | |
| SGD closest match: | S000003842 | EAF6 | Chromatin modification-related protein EAF6 |
| CGD closest match: | CAL0000192577 | EAF6 | Chromatin modification-related protein EAF6 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01912_1 | 70.09% | 107 | 6e-54 | MIA_01912_1 |
| A0A0J9XCC6_GEOCN | 67.27% | 110 | 6e-48 | Similar to Saccharomyces cerevisiae YJR082C EAF6 Subunit of the NuA4 acetyltransferase complex OS=Geotrichum candidum GN=BN980_GECA10s01033g PE=4 SV=1 |
| A0A060T764_BLAAD | 58.42% | 101 | 2e-37 | ARAD1C18568p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C18568g PE=4 SV=1 |
| UniRef50_A0A060T764 | 58.42% | 101 | 4e-34 | ARAD1C18568p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060T764_BLAAD |
| A0A1E3PH95_9ASCO | 55.86% | 111 | 6e-31 | NuA4-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47368 PE=4 SV=1 |
| EAF6_YARLI | 56.32% | 87 | 5e-30 | Chromatin modification-related protein EAF6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EAF6 PE=3 SV=1 |
| A0A1E4THJ6_9ASCO | 47.50% | 80 | 6e-23 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_69234 PE=4 SV=1 |
| EAF6_CANAL | 38.04% | 92 | 6e-13 | Chromatin modification-related protein EAF6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EAF6 PE=3 SV=1 |
| EAF6_YEAST | 32.00% | 100 | 5e-12 | Chromatin modification-related protein EAF6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EAF6 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0196
Protein family membership
- Chromatin modification-related protein Eaf6 (IPR015418)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MCA_02553_1 MPPSSTETSQREATLDEYENVKSNLKELLTRKRSLDKNLNALEEQIYKAESLYLEDSTGGNIVKGFDNYIKGSQTKKRSG LNEQDRIFSMSSAVFLKVKMKEEDDKS
GO term prediction
Biological Process
GO:0016573 histone acetylation
Molecular Function
None predicted.
Cellular Component
GO:0000123 histone acetyltransferase complex