Protein

MIA_01864_1

Length
120 amino acids


Browser: contig02:1910294-1910765+

Protein function

EGGNOG:0PP8VRPL3160S ribosomal protein L31
SGD closest match:S000004398RPL31B60S ribosomal protein L31-B
CGD closest match:CAL0000188731orf19.3572.3Ribosomal 60S subunit protein L31B

Protein alignments

%idAln lengthE-value
MCA_01297_187.500%1203.19e-75MCA_01297_1
A0A0F7RQY1_GEOCN80.172%1161.10e-69Similar to Saccharomyces cerevisiae YDL075W RPL31A Ribosomal 60S subunit protein L31A OS=Geotrichum candidum GN=BN980_GECA04s05444g PE=4 SV=1
A0A060T1L3_BLAAD80.531%1138.73e-66ARAD1A01210p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A01210g PE=4 SV=1
Q6C4Q8_YARLI79.464%1121.30e-64YALI0E24475p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E24475g PE=4 SV=1
UniRef50_A0A0E9NBK569.048%1262.44e-57Uncharacterized protein n=2 Tax=Saitoella complicata NRRL Y-17804 TaxID=698492 RepID=A0A0E9NBK5_9ASCO
A0A1E3PLM1_9ASCO73.913%1156.21e-62Ribosomal protein L31e OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82708 PE=4 SV=1
A0A1E4T9K9_9ASCO64.706%1193.98e-54Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_46324 PE=4 SV=1
A0A1D8PHF5_CANAL70.000%1103.01e-53Ribosomal 60S subunit protein L31B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3572.3 PE=4 SV=1
RL31B_YEAST67.568%1111.94e-5060S ribosomal protein L31-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL31B PE=1 SV=1
A0A170QXP9_9ASCO73.913%693.23e-34Ribosomal 60S subunit protein L31B OS=Sugiyamaella lignohabitans GN=RPL31B PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.5550

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 120

Detailed signature matches

    1. PF01198 (Ribosomal_...)
    2. SM01380 (Ribosomal_...)
    3. MF_00410 (Ribosomal...)
    4. cd00463 (Ribosomal_...)
    1. SSF54575 (Ribosomal...)
    1. PS01144 (RIBOSOMAL_...)

Residue annotation

  1. 23S rRNA binding s...

Protein sequence

>MIA_01864_1
MAPSTKQRSAISDVVTREYTIHLHKRVFGLQFKKRAPRAVKAIKEFTKRHMGTTDVRIDPVLNKKLWERGIRGVPHRLRL
RISRKRNDEEGAKEKLFSYVQAVDVPSVKGLQTEVVAEDN

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome