Protein

MCA_01297_1

Length
120 amino acids


Browser: contigA:4075341-4076096-

RNA-seq: read pairs 33132, FPKM 3383.3, percentile rank 98.7% (100% = highest expression)

Protein function

KEGG:K02910RP-L31e large subunit ribosomal protein L31e
EGGNOG:0PP8VRPL3160S ribosomal protein L31
SGD closest match:S000004398RPL31B60S ribosomal protein L31-B
CGD closest match:CAL0000188731orf19.3572.3Ribosomal 60S subunit protein L31B

Protein alignments

%idAln lengthE-value
MIA_01864_187.50%1201e-73MIA_01864_1
A0A0F7RQY1_GEOCN75.00%1206e-66Similar to Saccharomyces cerevisiae YDL075W RPL31A Ribosomal 60S subunit protein L31A OS=Geotrichum candidum GN=BN980_GECA04s05444g PE=4 SV=1
Q6C4Q8_YARLI75.22%1133e-60YALI0E24475p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E24475g PE=4 SV=1
A0A060T1L3_BLAAD73.04%1152e-59ARAD1A01210p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A01210g PE=4 SV=1
A0A1E3PLM1_9ASCO69.03%1134e-56Ribosomal protein L31e OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82708 PE=4 SV=1
UniRef50_B2AAG970.18%1145e-51Podospora anserina S mat+ genomic DNA chromosome 1, supercontig 1 n=30 Tax=Fungi TaxID=4751 RepID=B2AAG9_PODAN
RL31B_YEAST69.37%1118e-5160S ribosomal protein L31-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL31B PE=1 SV=1
A0A1D8PHF5_CANAL67.57%1111e-50Ribosomal 60S subunit protein L31B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3572.3 PE=4 SV=1
A0A1E4T9K9_9ASCO59.50%1211e-49Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_46324 PE=4 SV=1
A0A170QXP9_9ASCO66.67%693e-29Ribosomal 60S subunit protein L31B OS=Sugiyamaella lignohabitans GN=RPL31B PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.4927

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 120

Detailed signature matches

    1. PF01198 (Ribosomal_...)
    2. SM01380 (Ribosomal_...)
    3. MF_00410 (Ribosomal...)
    4. cd00463 (Ribosomal_...)
    1. SSF54575 (Ribosomal...)
    1. PS01144 (RIBOSOMAL_...)

Residue annotation

  1. 23S rRNA binding s...

Protein sequence

>MCA_01297_1
MAPPKKQRSAISDVVTREYTIHLHKRVFGLQFKKRAPRAVKAIKEFAKRHMGTSDVRIAPELNKKLWERGVTGVPHRLRI
RIARKRNDEENAKEKLFSYVSHVDVPSVKGLQTEVVSEDD

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome