Protein

MIA_01800_1

Length
137 amino acids

Browser: contig02:1705763-1706177+

Protein function

EGGNOG:0PNTKHTA1Core component of nucleosome which plays a central role in DNA double strand break (DSB) repair. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling
SGD closest match:S000002633HTA1Histone H2A.1
CGD closest match:CAL0000179664HTA1Histone H2A.1

Protein alignments

%idAln lengthE-value
MCA_02822_192.73%1105e-53MCA_02822_1
A0A161HL23_9ASCO94.74%953e-51Histone H2A OS=Sugiyamaella lignohabitans GN=HTA2 PE=3 SV=1
A0A1E3PTB0_9ASCO94.74%955e-51Histone H2A OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49298 PE=3 SV=1
A0A060T172_BLAAD93.68%958e-51Histone H2A OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C14344g PE=3 SV=1
A0A0J9X4D8_GEOCN93.68%953e-50Histone H2A OS=Geotrichum candidum GN=BN980_GECA01s08535g PE=3 SV=1
H2A_YARLI90.53%957e-50Histone H2A OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HTA1 PE=3 SV=3
H2A1_CANAL92.63%953e-49Histone H2A.1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HTA1 PE=3 SV=3
H2A1_YEAST83.64%1103e-48Histone H2A.1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HTA1 PE=1 SV=2
UniRef50_P0491183.64%1107e-45Histone H2A.1 n=584 Tax=Eukaryota TaxID=2759 RepID=H2A1_YEAST
A0A1E4TCQ8_9ASCO93.68%951e-46Histone H2A OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_140435 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9903
Predicted cleavage: 49

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 137

Detailed signature matches

  1. Family IPR002119
    Histone H2A
    1. PR00620 (HISTONEH2A)
    2. SM00414 (h2a4)
  2. Domain IPR009072
    Histone-fold
    1. SSF47113 (Histone-fold)
  3. Domain IPR007125
    Histone H2A/H2B/H3
    1. PF00125 (Histone)
  4. Domain IPR032454
    Histone H2A, C-terminal domain
    1. PF16211 (Histone_H2A_C)
  5. SITE IPR032458
    Histone H2A conserved site
    1. PS00046 (HISTONE_H2A)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.10.20.10
  2. cd00074 (H2A)
  3. mobidb-lite (disord...)

Residue annotation

  1. DNA binding site c...
  2. homodimerization i...
  3. H2A-H2B dimerizati...
  4. ubiquitination sit...

Protein sequence

>MIA_01800_1
MSGGKSGGKAASSASAKSSQSRSSKAGLTFPVGRVHRILRKGNYAQRIGAGAPVYLASVLEYLAAEILELAGNAARDNRK
TRIIPRHLQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLRPKKTAKTAKTGASQEL

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003677 DNA binding
GO:0046982 protein heterodimerization activity

Cellular Component

GO:0000786 nucleosome
GO:0005634 nucleus