Protein
MCA_02822_1
Length
137 amino acids
Gene name: HTA1
Description: Histone H2A.1
Browser: contigB:2459592-2460006-
RNA-seq: read pairs 12789, FPKM 1145.1, percentile rank 96.9% (100% = highest expression)
Protein function
| Annotation: | HTA1 | Histone H2A.1 | |
|---|---|---|---|
| KEGG: | K11251 | H2A | histone H2A |
| EGGNOG: | 0PNTK | HTA1 | Core component of nucleosome which plays a central role in DNA double strand break (DSB) repair. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling |
| SGD closest match: | S000002633 | HTA1 | Histone H2A.1 |
| CGD closest match: | CAL0000179664 | HTA1 | Histone H2A.1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01800_1 | 92.73% | 110 | 3e-58 | MIA_01800_1 |
| A0A060T172_BLAAD | 90.00% | 110 | 9e-55 | Histone H2A OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C14344g PE=3 SV=1 |
| A0A161HL23_9ASCO | 89.09% | 110 | 5e-54 | Histone H2A OS=Sugiyamaella lignohabitans GN=HTA2 PE=3 SV=1 |
| H2A_YARLI | 86.36% | 110 | 1e-53 | Histone H2A OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HTA1 PE=3 SV=3 |
| H2A1_YEAST | 88.18% | 110 | 1e-52 | Histone H2A.1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HTA1 PE=1 SV=2 |
| UniRef50_P04911 | 88.18% | 110 | 4e-49 | Histone H2A.1 n=584 Tax=Eukaryota TaxID=2759 RepID=H2A1_YEAST |
| A0A0J9X4D8_GEOCN | 87.27% | 110 | 4e-52 | Histone H2A OS=Geotrichum candidum GN=BN980_GECA01s08535g PE=3 SV=1 |
| A0A1E4TCQ8_9ASCO | 89.09% | 110 | 6e-51 | Histone H2A OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_140435 PE=3 SV=1 |
| H2A1_CANAL | 85.45% | 110 | 1e-50 | Histone H2A.1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HTA1 PE=3 SV=3 |
| A0A1E3PTB0_9ASCO | 94.74% | 95 | 4e-50 | Histone H2A OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49298 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9642
Predicted cleavage: 49
Protein family membership
- Histone H2A (IPR002119)
Domains and repeats
-
Domain
-
Domain
1
20
40
60
80
100
120
137
Detailed signature matches
no IPR
Unintegrated signatures
-
-
cd00074 (H2A)
-
mobidb-lite (disord...)
Residue annotation
-
DNA binding site c...
-
homodimerization i...
-
H2A-H2B dimerizati...
-
ubiquitination sit...
Protein sequence
>MCA_02822_1 MSGGKSGGKAGSGASGKASQSRSSKAGLTFPVGRIHRLLRKGNYAQRIGAGAPVYLCAVLEYLAAEILELAGNAARDNRK TRIIPRHLQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLRPKKTPKAAKAGQSQEL
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0003677 DNA binding
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus