Protein

MIA_01780_1

Length
210 amino acids

Browser: contig02:1664951-1665737-

Protein function

EGGNOG:0PG8YRPL15Ribosomal protein L15
SGD closest match:S000004019RPL15A60S ribosomal protein L15-A
CGD closest match:CAL0000190553RPL15ARibosomal protein L15

Protein alignments

%idAln lengthE-value
MCA_02852_290.640%2036.18e-128MCA_02852_2
A0A0J9X4S7_GEOCN87.685%2037.66e-125Ribosomal protein L15 OS=Geotrichum candidum GN=BN980_GECA02s00417g PE=3 SV=1
A0A1E3PDS2_9ASCO83.333%2049.77e-120Ribosomal protein L15 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_67577 PE=3 SV=1
A0A167FKX8_9ASCO85.714%2036.64e-119Ribosomal protein L15 OS=Sugiyamaella lignohabitans GN=RPL15B PE=3 SV=1
RL15A_YEAST85.714%2031.29e-11860S ribosomal protein L15-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL15A PE=1 SV=3
UniRef50_P5478085.714%2033.89e-11560S ribosomal protein L15-B n=460 Tax=Eukaryota TaxID=2759 RepID=RL15B_YEAST
Q5A6R1_CANAL85.714%2037.28e-118Ribosomal protein L15 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL15A PE=3 SV=1
Q6C7Y3_YARLI83.744%2031.29e-116Ribosomal protein L15 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D24387g PE=3 SV=1
A0A060TA69_BLAAD83.744%2033.70e-116Ribosomal protein L15 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B05104g PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1412

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 200 210

Detailed signature matches

  1. Family IPR000439
    Ribosomal protein L15e
    1. SM01384 (Ribosomal_...)
    2. PF00827 (Ribosomal_...)
  2. Domain IPR012678
    Ribosomal protein L23/L15e core domain
    1. SSF54189 (Ribosomal...)
  3. Domain IPR024794
    Ribosomal protein L15e core domain
    1. G3DSA:3.40.11...

Protein sequence

>MIA_01780_1
MDIPFSKMGAYKYLEELHRKKQSDVLRFILRIRCWEYRQLKAIHRATRPSRPDKAHRLGYKAKQGFVIYRIRVRRGGRKR
PVHKGATYGKPTNQGVSQLKYQRSLRATAEERVGRRAANLRVLNSYWVNQDSTYKYFEVILVDPQHNSIRNDPRYNWIAK
PVHKHREARALTSTGKKSRGINKGHKYNNTKAGRRHTWKKNNTLSLWRFR

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome