Protein

MCA_02852_2

Length
203 amino acids


Gene name: RPL15

Description: Large subunit ribosomal protein L15

Browser: contigB:2518641-2519605+

RNA-seq: read pairs 51494, FPKM 3118.9, percentile rank 98.5% (100% = highest expression)

Protein function

Annotation:RPL15Large subunit ribosomal protein L15
KEGG:K02877RP-L15e large subunit ribosomal protein L15e
EGGNOG:0PG8YRPL15Ribosomal protein L15
SGD closest match:S000004728RPL15B60S ribosomal protein L15-B
CGD closest match:CAL0000190553RPL15ARibosomal protein L15

Protein alignments

%idAln lengthE-value
MIA_01780_190.64%2033e-118MIA_01780_1
A0A0J9X4S7_GEOCN86.21%2037e-112Ribosomal protein L15 OS=Geotrichum candidum GN=BN980_GECA02s00417g PE=3 SV=1
Q6C7Y3_YARLI83.25%2032e-107Ribosomal protein L15 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D24387g PE=3 SV=1
Q5A6R1_CANAL83.74%2031e-106Ribosomal protein L15 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL15A PE=3 SV=1
UniRef50_Q8X03481.77%2032e-10360S ribosomal protein L15 n=158 Tax=Fungi TaxID=4751 RepID=RL15_NEUCR
RL15B_YEAST82.76%2032e-10560S ribosomal protein L15-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL15B PE=1 SV=2
A0A060TA69_BLAAD81.77%2032e-104Ribosomal protein L15 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B05104g PE=3 SV=1
A0A1E3PDS2_9ASCO81.77%2032e-104Ribosomal protein L15 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_67577 PE=3 SV=1
A0A167FKX8_9ASCO80.79%2033e-103Ribosomal protein L15 OS=Sugiyamaella lignohabitans GN=RPL15B PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1124

Protein family membership

Domains and repeats

1 20 40 60 80 100 120 140 160 180 203

Detailed signature matches

    1. SM01384 (Ribosomal_...)
    2. PF00827 (Ribosomal_...)
    1. SSF54189 (Ribosomal...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_02852_2
MGAYKYLEELHKKKQSDVMRFILRIRCWEYRQLKAVHRASRPSRPDKAHRLGYKAKQGFVIYRVRVRRGGRKRPVHKGAT
YGKPTNQGVTQLKYQRTHRATAEERAGRRAGNLRVLNSYWVNQDSTYKYFEVILVDPNHNAIRNDPRINWICNPVHKHRE
ARALTSTGKKSRGINKGHRYNNTKKGRRHTWKNNNTLSLWRYR

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome