Protein

MIA_01736_1

Length
361 amino acids


Browser: contig02:1540414-1541500+

Protein function

EGGNOG:0PIMKDRE2Component of the cytosolic iron-sulfur (Fe S) protein assembly machinery. Required for the maturation of extramitochondrial Fe S proteins (By similarity). Has anti- apoptotic effects in the cell. Involved in negative control of H(2)O(2)-induced cell death, probably by tethering the pro- apoptotic factor tah18 in the cytoplasm in the absence of oxidative stress (By similarity)
SGD closest match:S000001779DRE2Fe-S cluster assembly protein DRE2
CGD closest match:CAL0000199333DRE2Fe-S cluster assembly protein DRE2

Protein alignments

%idAln lengthE-value
MCA_01466_152.910%3786.43e-96MCA_01466_1
A0A0J9XKJ8_GEOCN41.210%3474.57e-46Fe-S cluster assembly protein DRE2 OS=Geotrichum candidum GN=DRE2 PE=3 SV=1
UniRef50_A0A0J9XKJ841.210%3479.35e-43Fe-S cluster assembly protein DRE2 n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XKJ8_GEOCN
A0A060TI70_BLAAD34.706%3402.86e-39Fe-S cluster assembly protein DRE2 OS=Blastobotrys adeninivorans GN=DRE2 PE=3 SV=1
A0A167G0E1_9ASCO37.069%3482.28e-36Fe-S cluster assembly protein DRE2 OS=Sugiyamaella lignohabitans GN=DRE2 PE=3 SV=1
DRE2_YARLI64.486%1071.52e-35Fe-S cluster assembly protein DRE2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DRE2 PE=3 SV=1
A0A1E3PPC7_9ASCO32.029%4091.12e-33Fe-S cluster assembly protein DRE2 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=DRE2 PE=3 SV=1
A0A1E4TDF5_9ASCO59.055%1273.63e-30Fe-S cluster assembly protein DRE2 OS=Tortispora caseinolytica NRRL Y-17796 GN=DRE2 PE=3 SV=1
DRE2_CANAL42.857%1408.15e-24Fe-S cluster assembly protein DRE2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DRE2 PE=3 SV=1
DRE2_YEAST68.627%512.26e-17Fe-S cluster assembly protein DRE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRE2 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0965

Protein family membership

Domains and repeats

1 50 100 150 200 250 300 361

Detailed signature matches

    1. MF_03115 (Anamorsin)
    2. PF05093 (CIAPIN1)
    1. PF16803 (DRE2_N)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MIA_01736_1
MPEPTSNILTTPINRILLLLTADAVKSPQFVESITNKFKHNVSTNEIHRHVLDRVLSGAAKLPSCYFSTVYYLPSSSEEQ
EELFTTPGALESLFDSIEYNGTLQTLLLSSASSPDIPVITPKMITTAIIAGFLQSDDKLSFKKPHQLVESTAPATLLNRR
SKVQSDKTTENTTITTKKKLPIFKRKQTDATTENDSVSLKTTNLPQNSDNLSSGVVKLTLSDDFNDNDDSMDDGLIDENT
LLMEAAKNLSKPIVLPAKCDPGPGKRRRKACKDCTCGLRELEIQEEEEQRKKQDAVILNLDGDGGDDDYAIDFTVTVGKP
VGSCGSCALGDAFRCDSCPYLGLPPFKPGEIIDITSIKNDL

GO term prediction

Biological Process

GO:0016226 iron-sulfur cluster assembly

Molecular Function

GO:0051536 iron-sulfur cluster binding

Cellular Component

GO:0005737 cytoplasm