Protein
MIA_01695_1
Length
58 amino acids
Browser: contig02:1430536-1430792+
Protein function
| EGGNOG: | 0PSH7 | COX9 | This small integral protein plays a role in holoenzyme assembly or stability (By similarity) |
|---|---|---|---|
| SGD closest match: | S000002225 | COX9 | Cytochrome c oxidase subunit 7A |
| CGD closest match: | CAL0000198058 | COX9 | Cytochrome c oxidase subunit 7A |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XIC7_GEOCN | 66.102% | 59 | 1.46e-23 | Cytochrome c oxidase subunit 7A OS=Geotrichum candidum GN=BN980_GECA18s01913g PE=4 SV=1 |
| MCA_04373_1 | 63.158% | 57 | 3.38e-20 | MCA_04373_1 |
| A0A060SWS3_BLAAD | 52.632% | 57 | 7.15e-20 | Cytochrome c oxidase subunit 7A OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A07568g PE=4 SV=1 |
| UniRef50_W0TCG0 | 45.614% | 57 | 2.87e-14 | Cytochrome c oxidase subunit 7A n=1 Tax=Kluyveromyces marxianus DMKU3-1042 TaxID=1003335 RepID=W0TCG0_KLUMA |
| A0A1E3PST2_9ASCO | 51.852% | 54 | 9.45e-18 | Cytochrome c oxidase subunit 7A OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_19501 PE=4 SV=1 |
| COX9_YEAST | 42.105% | 57 | 1.44e-15 | Cytochrome c oxidase subunit 7A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX9 PE=1 SV=2 |
| B5RSK7_YARLI | 41.071% | 56 | 2.09e-12 | YALI0F04114p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F04114g PE=4 SV=1 |
| A0A1D8PHI5_CANAL | 47.170% | 53 | 4.12e-12 | Cytochrome c oxidase subunit 7A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX9 PE=4 SV=1 |
| A0A1E4TF05_9ASCO | 47.826% | 46 | 4.22e-06 | Cytochrome c oxidase subunit 7A OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31353 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0444
Protein family membership
- Cytochrome c oxidase, subunit VIIa, fungal (IPR014368)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_01695_1 MVAPIVGTLKKKIITDITVSFVVGGALAAGWWYGIHNGYVKQRENWYAEYEKTKGQDD
GO term prediction
Biological Process
GO:0022904 respiratory electron transport chain
GO:0055114 oxidation-reduction process
Molecular Function
GO:0004129 cytochrome-c oxidase activity
Cellular Component
GO:0005746 mitochondrial respiratory chain