Protein
MCA_04373_1
Length
55 amino acids
Browser: contigC:2826148-2826662+
RNA-seq: read pairs 17245, FPKM 3805.0, percentile rank 99.0% (100% = highest expression)
Protein function
KEGG: | K02269 | COX7 | cytochrome c oxidase subunit 7 |
---|---|---|---|
SGD closest match: | S000002225 | COX9 | Cytochrome c oxidase subunit 7A |
CGD closest match: | CAL0000198058 | COX9 | Cytochrome c oxidase subunit 7A |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_01695_1 | 63.16% | 57 | 3e-19 | MIA_01695_1 |
A0A060SWS3_BLAAD | 58.93% | 56 | 3e-18 | Cytochrome c oxidase subunit 7A OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A07568g PE=4 SV=1 |
A0A0J9XIC7_GEOCN | 60.38% | 53 | 2e-16 | Cytochrome c oxidase subunit 7A OS=Geotrichum candidum GN=BN980_GECA18s01913g PE=4 SV=1 |
A0A1E3PST2_9ASCO | 52.73% | 55 | 7e-16 | Cytochrome c oxidase subunit 7A OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_19501 PE=4 SV=1 |
COX9_YEAST | 42.86% | 56 | 3e-13 | Cytochrome c oxidase subunit 7A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX9 PE=1 SV=2 |
UniRef50_P07255 | 42.86% | 56 | 7e-10 | Cytochrome c oxidase subunit 7A n=22 Tax=Saccharomycetales TaxID=4892 RepID=COX9_YEAST |
B5RSK7_YARLI | 41.07% | 56 | 3e-12 | YALI0F04114p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F04114g PE=4 SV=1 |
A0A1D8PHI5_CANAL | 46.43% | 56 | 8e-09 | Cytochrome c oxidase subunit 7A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX9 PE=4 SV=1 |
A0A1E4TF05_9ASCO | 52.17% | 46 | 4e-07 | Cytochrome c oxidase subunit 7A OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31353 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0026
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_04373_1 MVKPITGALKKKIILDITTAIGGGLASWWWYGYHNGQVAVREKWYAEYEKSKSEE
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.