Protein
MIA_01694_1
Length
76 amino acids
Browser: contig02:1429509-1429797-
Protein function
EGGNOG: | 0PSJH | cytochrome C oxidase | |
---|---|---|---|
SGD closest match: | S000004387 | COX8 | Cytochrome c oxidase polypeptide VIII, mitochondrial |
CGD closest match: | CAL0000201695 | COX8 | Cytochrome c oxidase subunit VIII |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_04372_1 | 71.795% | 78 | 6.52e-36 | MCA_04372_1 |
A0A0J9XHL9_GEOCN | 69.333% | 75 | 5.82e-35 | Similar to Saccharomyces cerevisiae YLR395C COX8 Subunit VIII of cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA18s01924g PE=4 SV=1 |
UniRef50_A0A0J9XHL9 | 69.333% | 75 | 1.19e-31 | Similar to Saccharomyces cerevisiae YLR395C COX8 Subunit VIII of cytochrome c oxidase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XHL9_GEOCN |
A0A1E3PRG2_9ASCO | 59.211% | 76 | 1.15e-29 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_68253 PE=4 SV=1 |
A0A060SXV1_BLAAD | 57.143% | 77 | 1.45e-27 | ARAD1A07546p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A07546g PE=4 SV=1 |
Q6C2Y3_YARLI | 45.946% | 74 | 3.07e-21 | YALI0F04103p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F04103g PE=4 SV=1 |
A0A1E4T9L9_9ASCO | 49.180% | 61 | 1.87e-16 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4590 PE=4 SV=1 |
COX8_YEAST | 40.789% | 76 | 1.30e-16 | Cytochrome c oxidase polypeptide VIII, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX8 PE=1 SV=2 |
A0A1D8PHJ3_CANAL | 37.975% | 79 | 6.50e-09 | Cytochrome c oxidase subunit VIII OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX8 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9986
Predicted cleavage: 26
Protein family membership
- Cytochrome c oxidase subunit VIIc (IPR004202)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_01694_1 MLSRAAARTTSLVTRRGFSSSAVSKLEHHWPEGPYTNIPFKVHNRKIPYFIIHWTYFIVGLGSPFAICYYQLKKSS
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0004129 cytochrome-c oxidase activity
Cellular Component
None predicted.