Protein

MIA_01694_1

Length
76 amino acids

Browser: contig02:1429509-1429797-

Protein function

EGGNOG:0PSJHcytochrome C oxidase
SGD closest match:S000004387COX8Cytochrome c oxidase polypeptide VIII, mitochondrial
CGD closest match:CAL0000201695COX8Cytochrome c oxidase subunit VIII

Protein alignments

%idAln lengthE-value
MCA_04372_171.795%786.52e-36MCA_04372_1
A0A0J9XHL9_GEOCN69.333%755.82e-35Similar to Saccharomyces cerevisiae YLR395C COX8 Subunit VIII of cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA18s01924g PE=4 SV=1
UniRef50_A0A0J9XHL969.333%751.19e-31Similar to Saccharomyces cerevisiae YLR395C COX8 Subunit VIII of cytochrome c oxidase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XHL9_GEOCN
A0A1E3PRG2_9ASCO59.211%761.15e-29Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_68253 PE=4 SV=1
A0A060SXV1_BLAAD57.143%771.45e-27ARAD1A07546p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A07546g PE=4 SV=1
Q6C2Y3_YARLI45.946%743.07e-21YALI0F04103p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F04103g PE=4 SV=1
A0A1E4T9L9_9ASCO49.180%611.87e-16Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4590 PE=4 SV=1
COX8_YEAST40.789%761.30e-16Cytochrome c oxidase polypeptide VIII, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX8 PE=1 SV=2
A0A1D8PHJ3_CANAL37.975%796.50e-09Cytochrome c oxidase subunit VIII OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX8 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9986
Predicted cleavage: 26

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR004202
    Cytochrome c oxidase subunit VIIc
    1. G3DSA:4.10.49.10
    2. SSF81427 (Mitochond...)
    3. PF02935 (COX7C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. NON_CYTOPLASM... (N...)
  3. TMhelix
  4. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_01694_1
MLSRAAARTTSLVTRRGFSSSAVSKLEHHWPEGPYTNIPFKVHNRKIPYFIIHWTYFIVGLGSPFAICYYQLKKSS

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0004129 cytochrome-c oxidase activity

Cellular Component

None predicted.