Protein

MCA_04372_1

Length
76 amino acids


Gene name: COX8

Description: Cytochrome c oxidase polypeptide VIII, mitochondrial

Browser: contigC:2824965-2825273-

RNA-seq: read pairs 29876, FPKM 4794.1, percentile rank 99.6% (100% = highest expression)

Protein function

Annotation:COX8Cytochrome c oxidase polypeptide VIII, mitochondrial
KEGG:K02272COX7C cytochrome c oxidase subunit 7c
EGGNOG:0PSJHcytochrome C oxidase
SGD closest match:S000004387COX8Cytochrome c oxidase polypeptide VIII, mitochondrial
CGD closest match:CAL0000201695COX8Cytochrome c oxidase subunit VIII

Protein alignments

%idAln lengthE-value
MIA_01694_171.79%781e-34MIA_01694_1
A0A060SXV1_BLAAD62.34%776e-31ARAD1A07546p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A07546g PE=4 SV=1
A0A0J9XHL9_GEOCN67.11%764e-30Similar to Saccharomyces cerevisiae YLR395C COX8 Subunit VIII of cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA18s01924g PE=4 SV=1
UniRef50_A0A0J9XHL967.11%769e-27Similar to Saccharomyces cerevisiae YLR395C COX8 Subunit VIII of cytochrome c oxidase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XHL9_GEOCN
A0A1E3PRG2_9ASCO56.58%764e-26Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_68253 PE=4 SV=1
Q6C2Y3_YARLI58.33%725e-24YALI0F04103p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F04103g PE=4 SV=1
A0A1E4T9L9_9ASCO56.34%712e-21Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4590 PE=4 SV=1
COX8_YEAST44.30%792e-14Cytochrome c oxidase polypeptide VIII, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX8 PE=1 SV=2
A0A1D8PHJ3_CANAL37.93%878e-13Cytochrome c oxidase subunit VIII OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX8 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9870
Predicted cleavage: 54

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. SSF81427 (Mitochond...)
    2. PF02935 (COX7C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MCA_04372_1
MLSRAALRTSSNLVSKRAFSSTSVTKMHWPEGPYTNIPFKVHNRKFVPYWVLHWGFFITGLGAPFAIVYYQLKKSS

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0004129 cytochrome-c oxidase activity

Cellular Component

None predicted.