Protein
MIA_01679_1
Length
191 amino acids
Browser: contig02:1380542-1381118-
Protein function
EGGNOG: | 0PMZU | PAM17 | Component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner |
---|---|---|---|
SGD closest match: | S000001773 | PAM17 | Presequence translocated-associated motor subunit PAM17, mitochondrial |
CGD closest match: | CAL0000186714 | PAM17 | Presequence translocated-associated motor subunit PAM17, mitochondrial |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9X5Q7_GEOCN | 62.011% | 179 | 8.08e-63 | Similar to Saccharomyces cerevisiae YKR065C PAM17 constituent of the translocase of the inner mitochondrial membrane (TIM23 complex) OS=Geotrichum candidum GN=BN980_GECA03s07171g PE=4 SV=1 |
UniRef50_A0A0J9X5Q7 | 62.011% | 179 | 1.65e-59 | Similar to Saccharomyces cerevisiae YKR065C PAM17 constituent of the translocase of the inner mitochondrial membrane (TIM23 complex) n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X5Q7_GEOCN |
MCA_01068_1 | 57.209% | 215 | 3.23e-62 | MCA_01068_1 |
A0A167DS83_9ASCO | 55.034% | 149 | 1.70e-52 | Pam17p OS=Sugiyamaella lignohabitans GN=PAM17 PE=4 SV=1 |
PAM17_YEAST | 46.199% | 171 | 2.79e-48 | Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAM17 PE=1 SV=1 |
A0A060SXM5_BLAAD | 56.051% | 157 | 1.02e-43 | ARAD1A10516p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A10516g PE=4 SV=1 |
PAM17_CANAL | 43.258% | 178 | 2.16e-39 | Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAM17 PE=3 SV=3 |
A0A1E3PE01_9ASCO | 45.033% | 151 | 3.25e-38 | Pam17-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84266 PE=4 SV=1 |
A0A1E4TKR4_9ASCO | 38.150% | 173 | 1.31e-36 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_84899 PE=4 SV=1 |
PAM17_YARLI | 46.250% | 160 | 8.11e-33 | Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAM17 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9894
Predicted cleavage: 37
Protein family membership
- Mitochondrial import protein Pam17 (IPR013875)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_01679_1 MLRIGLSVPRTGLLLSGLRTNSLAASRSLVLRRFNSTQSAPFLSWNDFLAKRLQRRRLNLVASVVTGFFGMSAGWAVIAN IEINPAEPIFGFDAMIVLPAGLLLCAGAGSLLGPSLGSSIFKLSLGKSFPEFANKNAQFLRHVQRNRPDPSKQTYANPVP DYYGEKIGSLKDYRRWLRDCHAYRRKVETFL
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.