Protein
MCA_01068_1
Length
215 amino acids
Gene name: PAM17
Description: Presequence translocated-associated motor subunit PAM17, mitochondrial
Browser: contigA:3394432-3395080+
RNA-seq: read pairs 3198, FPKM 182.9, percentile rank 87.0% (100% = highest expression)
Protein function
| Annotation: | PAM17 | Presequence translocated-associated motor subunit PAM17, mitochondrial | |
|---|---|---|---|
| KEGG: | K17806 | PAM17 | mitochondrial import inner membrane translocase subunit TIM23 |
| EGGNOG: | 0PMZU | PAM17 | Component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner |
| SGD closest match: | S000001773 | PAM17 | Presequence translocated-associated motor subunit PAM17, mitochondrial |
| CGD closest match: | CAL0000186714 | PAM17 | Presequence translocated-associated motor subunit PAM17, mitochondrial |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01679_1 | 56.28% | 215 | 3e-75 | MIA_01679_1 |
| A0A0J9X5Q7_GEOCN | 58.66% | 179 | 1e-69 | Similar to Saccharomyces cerevisiae YKR065C PAM17 constituent of the translocase of the inner mitochondrial membrane (TIM23 complex) OS=Geotrichum candidum GN=BN980_GECA03s07171g PE=4 SV=1 |
| UniRef50_A0A0J9X5Q7 | 58.66% | 179 | 2e-66 | Similar to Saccharomyces cerevisiae YKR065C PAM17 constituent of the translocase of the inner mitochondrial membrane (TIM23 complex) n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X5Q7_GEOCN |
| A0A167DS83_9ASCO | 43.69% | 206 | 2e-61 | Pam17p OS=Sugiyamaella lignohabitans GN=PAM17 PE=4 SV=1 |
| A0A060SXM5_BLAAD | 57.89% | 152 | 5e-52 | ARAD1A10516p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A10516g PE=4 SV=1 |
| PAM17_YEAST | 41.29% | 201 | 4e-52 | Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAM17 PE=1 SV=1 |
| PAM17_CANAL | 46.05% | 152 | 4e-45 | Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAM17 PE=3 SV=3 |
| A0A1E4TKR4_9ASCO | 42.48% | 153 | 2e-41 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_84899 PE=4 SV=1 |
| A0A1E3PE01_9ASCO | 37.22% | 180 | 3e-40 | Pam17-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84266 PE=4 SV=1 |
| PAM17_YARLI | 45.03% | 151 | 3e-34 | Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAM17 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9993
Predicted cleavage: 38
Protein family membership
- Mitochondrial import protein Pam17 (IPR013875)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_01068_1 MLQFGLGSARAPLTTSVLRRAAQSVSRRSFHQSKIFRQELKASSSSSAHNETAQHIKVDHSQFLPWNDFLAKRIQRRRMN LVASVFTGLLGVGAGWVVIANVEIDPTQPILGMDPLIMLPIGVVLCGTAGALCGPSLGSLLFKWTVLGGKQNVSAFMAQN AEFLRHVKLNRPDPSKQTYANPVPDYYGEKIGSLKDYRTWLRDGRAYRRKVETFL
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.