Protein
MIA_01579_1
Length
82 amino acids
Browser: contig02:1124833-1125140-
Protein function
EGGNOG: | 0PRUS | PGUG_05228 | mitochondrial respiratory chain complex II biogenesis |
---|---|---|---|
SGD closest match: | S000007605 | SDH6 | Succinate dehydrogenase assembly factor 1, mitochondrial |
CGD closest match: | CAL0000193191 | orf19.4593.1 | Uncharacterized protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_03135_1 | 74.684% | 79 | 2.46e-41 | MCA_03135_1 |
A0A1E3PHI4_9ASCO | 57.500% | 80 | 6.64e-31 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83885 PE=3 SV=1 |
A0A060TDB6_BLAAD | 64.384% | 73 | 3.18e-30 | ARAD1D49610p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D49610g PE=3 SV=1 |
A0A0J9XCZ2_GEOCN | 55.000% | 80 | 4.51e-26 | Similar to Saccharomyces cerevisiae YDR379C-A SDH6 Protein involved in the assembly of the mitochondrial succinate dehydrogenase complex OS=Geotrichum candidum GN=BN980_GECA10s00626g PE=3 SV=1 |
Q6CD86_YARLI | 52.564% | 78 | 7.98e-25 | YALI0C02871p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C02871g PE=3 SV=1 |
UniRef50_W6QG76 | 48.000% | 75 | 1.82e-21 | Succinate dehydrogenase assembly factor 1 homolog A, mitochondrial n=43 Tax=saccharomyceta TaxID=716545 RepID=W6QG76_PENRF |
A0A1D8PLE7_CANAL | 45.333% | 75 | 7.05e-22 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4593.1 PE=3 SV=1 |
SDHF1_YEAST | 46.053% | 76 | 1.47e-20 | Succinate dehydrogenase assembly factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH6 PE=1 SV=1 |
A0A1E4TK43_9ASCO | 43.836% | 73 | 2.59e-20 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_82651 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1497
Predicted cleavage: 15
Protein family membership
- Complex 1 LYR protein (IPR008011)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF05347 (Complex1_LYR)
-
Protein sequence
>MIA_01579_1 MVKSRKLSGLQREVLALYRESIRAVYKKPAEAQPNFREFARRNFRQYSGMSRKEFGAIEHLIRKGKKMLELYTNPGVRNI VL
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.