Protein
MCA_03135_1
Length
82 amino acids
Browser: contigB:3463052-3463427+
RNA-seq: read pairs 675, FPKM 100.5, percentile rank 78.7% (100% = highest expression)
Protein function
KEGG: | K18167 | SDHAF1 | succinate dehydrogenase assembly factor 1 |
---|---|---|---|
EGGNOG: | 0PRUS | PGUG_05228 | mitochondrial respiratory chain complex II biogenesis |
SGD closest match: | S000007605 | SDH6 | Succinate dehydrogenase assembly factor 1, mitochondrial |
CGD closest match: | CAL0000193191 | orf19.4593.1 | Uncharacterized protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_01579_1 | 74.68% | 79 | 5e-40 | MIA_01579_1 |
A0A060TDB6_BLAAD | 65.75% | 73 | 5e-31 | ARAD1D49610p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D49610g PE=3 SV=1 |
A0A0J9XCZ2_GEOCN | 62.50% | 80 | 4e-31 | Similar to Saccharomyces cerevisiae YDR379C-A SDH6 Protein involved in the assembly of the mitochondrial succinate dehydrogenase complex OS=Geotrichum candidum GN=BN980_GECA10s00626g PE=3 SV=1 |
A0A1E3PHI4_9ASCO | 55.00% | 80 | 3e-29 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83885 PE=3 SV=1 |
UniRef50_C5PEA9 | 54.32% | 81 | 2e-23 | Complex 1 protein (LYR family) protein n=5 Tax=leotiomyceta TaxID=716546 RepID=C5PEA9_COCP7 |
A0A1D8PLE7_CANAL | 48.68% | 76 | 8e-24 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4593.1 PE=3 SV=1 |
A0A1E4TK43_9ASCO | 45.95% | 74 | 6e-24 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_82651 PE=3 SV=1 |
SDHF1_YEAST | 50.00% | 78 | 3e-23 | Succinate dehydrogenase assembly factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH6 PE=1 SV=1 |
Q6CD86_YARLI | 54.05% | 74 | 1e-21 | YALI0C02871p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C02871g PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1239
Protein family membership
- Complex 1 LYR protein (IPR008011)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF05347 (Complex1_LYR)
-
Protein sequence
>MCA_03135_1 MAVRPKKLSGLQREVLALYRQCIRETYKKPIESQPNFRVFVRQSFDEYSSMSRKEFGAIEHLLRKGKKMLEMYSNPGVKN IH
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.