Protein
MIA_01567_1
Length
74 amino acids
Browser: contig02:1092808-1093087-
Protein function
| SGD closest match: | S000028510 | SUS1 | Transcription and mRNA export factor SUS1 |
|---|
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_04029_1 | 72.973% | 74 | 2.91e-37 | MCA_04029_1 |
| A0A0J9YH81_GEOCN | 59.420% | 69 | 1.74e-27 | Transcription and mRNA export factor SUS1 OS=Geotrichum candidum GN=SUS1 PE=3 SV=1 |
| UniRef50_A0A0J9YH81 | 59.420% | 69 | 3.55e-24 | Transcription and mRNA export factor SUS1 n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9YH81_GEOCN |
| SUS1_YARLI | 34.848% | 66 | 3.55e-12 | Transcription and mRNA export factor SUS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SUS1 PE=3 SV=1 |
| A0A1E4TBG4_9ASCO | 35.385% | 65 | 2.79e-11 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_27558 PE=3 SV=1 |
| SUS1_YEAST | 29.412% | 68 | 9.74e-09 | Transcription and mRNA export factor SUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUS1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3187
Protein family membership
- Transcription factor, enhancer of yellow 2 (IPR018783)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MIA_01567_1 MKSFLREKLLEAGWFDEINVLALDKLSTQEKPSFETVAESLESQALDMIPDDIKIELLRKIRSFLDTWVESKNS
GO term prediction
Biological Process
GO:0006406 mRNA export from nucleus
GO:0045893 positive regulation of transcription, DNA-templated
Molecular Function
GO:0003713 transcription coactivator activity
Cellular Component
GO:0000124 SAGA complex
GO:0005643 nuclear pore