Protein
MCA_04029_1
Length
97 amino acids
Gene name: SUS1
Description: Transcription and mRNA export factor SUS1
Browser: contigC:1808422-1808923+
RNA-seq: read pairs 278, FPKM 35.1, percentile rank 57.1% (100% = highest expression)
Protein function
| Annotation: | SUS1 | Transcription and mRNA export factor SUS1 | |
|---|---|---|---|
| KEGG: | K11368 | ENY2 | enhancer of yellow 2 transcription factor |
| EGGNOG: | 0PSHN | SUS1 | Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B and is involved in the maintenance of steady-state H3 methylation levels. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery. Has also a role in mRNP biogenesis and maintenance of genome integrity through preventing RNA-mediated genome instability (By similarity) |
| SGD closest match: | S000028510 | SUS1 | Transcription and mRNA export factor SUS1 |
| CGD closest match: | CAL0000178918 | SUS1 | Transcription and mRNA export factor SUS1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9YH81_GEOCN | 64.84% | 91 | 8e-40 | Transcription and mRNA export factor SUS1 OS=Geotrichum candidum GN=SUS1 PE=3 SV=1 |
| UniRef50_A0A0J9YH81 | 64.84% | 91 | 2e-36 | Transcription and mRNA export factor SUS1 n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9YH81_GEOCN |
| MIA_01567_1 | 72.97% | 74 | 7e-36 | MIA_01567_1 |
| SUS1_YARLI | 34.09% | 88 | 5e-18 | Transcription and mRNA export factor SUS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SUS1 PE=3 SV=1 |
| A0A1E4TBG4_9ASCO | 40.22% | 92 | 3e-16 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_27558 PE=3 SV=1 |
| SUS1_YEAST | 27.78% | 90 | 1e-10 | Transcription and mRNA export factor SUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUS1 PE=1 SV=1 |
| SUS1_CANAL | 25.47% | 106 | 2e-08 | Transcription and mRNA export factor SUS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SUS1 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0958
Protein family membership
- Transcription factor, enhancer of yellow 2 (IPR018783)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_04029_1 MSKPEEIKVKIHEKLLETGEYEKMKVFLRNKLQESGWFDEINVLALDRLSTQEKPSFDVIAESLESQALDLIPDEIKIEL LQQIKAFIDNWIETKTA
GO term prediction
Biological Process
GO:0006406 mRNA export from nucleus
GO:0045893 positive regulation of transcription, DNA-templated
Molecular Function
GO:0003713 transcription coactivator activity
Cellular Component
GO:0000124 SAGA complex
GO:0005643 nuclear pore