Protein

MIA_01541_1

Length
164 amino acids

Browser: contig02:1023167-1023706-

Protein function

EGGNOG:0PPQ7CBP4Essential for the assembly of ubiquinol-cytochrome c reductase. It has a direct effect on the correct occurrence of the Rieske protein, core 4, core 5 and apocytochrome b (By similarity)
SGD closest match:S000003406CBP4Assembly factor CBP4
CGD closest match:CAL0000197776CBP4Assembly factor CBP4

Protein alignments

%idAln lengthE-value
MCA_02474_155.357%1682.25e-45MCA_02474_1
A0A0J9XCL7_GEOCN53.374%1631.71e-41Similar to Saccharomyces cerevisiae YGR174C CBP4 Mitochondrial protein required for assembly of cytochrome bc1 complex OS=Geotrichum candidum GN=BN980_GECA08s01572g PE=4 SV=1
UniRef50_A0A0J9XCL753.374%1633.50e-38Similar to Saccharomyces cerevisiae YGR174C CBP4 Mitochondrial protein required for assembly of cytochrome bc1 complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XCL7_GEOCN
CBP4_YEAST39.623%1061.29e-09Assembly factor CBP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBP4 PE=1 SV=3
CBP4_CANAL29.936%1577.64e-06Assembly factor CBP4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBP4 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1499

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR012420
    Cbp4
    1. PF07960 (CBP4)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. NON_CYTOPLASM... (N...)
  3. PS51257 (PROKAR_LIP...)
  4. SIGNAL_PEPTIDE (Sig...)
  5. SIGNAL_PEPTID... (S...)
  6. SIGNAL_PEPTID... (S...)
  7. SIGNAL_PEPTID... (S...)
  8. TMhelix
  9. mobidb-lite (disord...)

Protein sequence

>MIA_01541_1
MSWARWIKTILAGGSVVGLGVSCFIFTTPTDDELIAKLSPELRQQYYDERERRRMVSQWAVGEARKTAASNNPIWMTGEI
PSGLVHGEDGEGRRVTAADAESVQRELTQDPDTARAFSEGLQYAPPSLMKQKDTWAAKQKMEKDRAIEEEKQRLRVLAEK
ESKA

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.