Protein
MCA_02474_1
Length
171 amino acids
Gene name: CBP4
Description: Assembly factor CBP4
Browser: contigB:1413972-1414575+
RNA-seq: read pairs 1292, FPKM 92.8, percentile rank 77.4% (100% = highest expression)
Protein function
| Annotation: | CBP4 | Assembly factor CBP4 | |
|---|---|---|---|
| EGGNOG: | 0PPQ7 | CBP4 | Essential for the assembly of ubiquinol-cytochrome c reductase. It has a direct effect on the correct occurrence of the Rieske protein, core 4, core 5 and apocytochrome b (By similarity) |
| SGD closest match: | S000003406 | CBP4 | Assembly factor CBP4 |
| CGD closest match: | CAL0000197776 | CBP4 | Assembly factor CBP4 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01541_1 | 54.17% | 168 | 7e-61 | MIA_01541_1 |
| A0A0J9XCL7_GEOCN | 53.22% | 171 | 3e-57 | Similar to Saccharomyces cerevisiae YGR174C CBP4 Mitochondrial protein required for assembly of cytochrome bc1 complex OS=Geotrichum candidum GN=BN980_GECA08s01572g PE=4 SV=1 |
| UniRef50_A0A0J9XCL7 | 53.22% | 171 | 6e-54 | Similar to Saccharomyces cerevisiae YGR174C CBP4 Mitochondrial protein required for assembly of cytochrome bc1 complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XCL7_GEOCN |
| CBP4_YEAST | 44.16% | 77 | 9e-17 | Assembly factor CBP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBP4 PE=1 SV=3 |
| A0A1E3PJF5_9ASCO | 49.30% | 71 | 2e-16 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83405 PE=4 SV=1 |
| A0A1E4TAH5_9ASCO | 40.00% | 75 | 2e-16 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13707 PE=4 SV=1 |
| CBP4_CANAL | 38.96% | 77 | 5e-13 | Assembly factor CBP4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBP4 PE=3 SV=1 |
| CBP4_YARLI | 28.40% | 81 | 3e-09 | Assembly factor CBP4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CBP4 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0659
Protein family membership
- Cbp4 (IPR012420)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_02474_1 MGAAAWIKAFVAGGGIVGLGVTCFIYTTPTDEELLAKLSPELRQKYYDQRDQRKYVGQWAYLQAKKTAASSDPIWMTGEI PSGLVPGEDGRGKRVSIPTPKDLKDSNNVPLSGNTTNQDELRVLSEGLQYAPKELVLEQNSWMRREQEEKRRALLQEKER LEKLAQEEENL
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.