Protein
MIA_01518_1
Length
129 amino acids
Browser: contig02:950321-950775-
Protein function
EGGNOG: | 0PRY2 | COX19 | Cytochrome c oxidase assembly protein cox19 |
---|---|---|---|
SGD closest match: | S000007245 | COX19 | Cytochrome c oxidase assembly protein COX19 |
CGD closest match: | CAL0000176572 | COX19 | Cytochrome c oxidase assembly protein COX19 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_01072_1 | 80.435% | 92 | 3.03e-52 | MCA_01072_1 |
A0A0J9XK26_GEOCN | 73.118% | 93 | 2.12e-47 | Similar to Saccharomyces cerevisiae YLL018C-A COX19 Protein required for cytochrome c oxidase assembly OS=Geotrichum candidum GN=BN980_GECA32s00120g PE=4 SV=1 |
A0A1E3PDW6_9ASCO | 70.270% | 74 | 1.91e-34 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53268 PE=4 SV=1 |
A0A060TH79_BLAAD | 63.750% | 80 | 5.17e-35 | ARAD1D36630p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D36630g PE=4 SV=1 |
COX19_YEAST | 61.728% | 81 | 5.00e-34 | Cytochrome c oxidase assembly protein COX19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX19 PE=1 SV=1 |
UniRef50_Q3E731 | 61.728% | 81 | 1.20e-30 | Cytochrome c oxidase assembly protein COX19 n=47 Tax=Opisthokonta TaxID=33154 RepID=COX19_YEAST |
B5FVG7_YARLI | 62.353% | 85 | 3.58e-33 | YALI0E34540p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E34540g PE=4 SV=1 |
COX19_CANAL | 58.750% | 80 | 3.40e-32 | Cytochrome c oxidase assembly protein COX19 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX19 PE=3 SV=2 |
A0A1E4TJ42_9ASCO | 55.000% | 80 | 8.07e-27 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_16218 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1440
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_01518_1 MASGAPGGGISKWIPNPPQRGSFPLDHDKECSLIMKDYLRCLKLVDGTNAHGCRLLAKSYLKCRMTHGLMEQDEWRNLGL PEDDKPLPLRKLPSHGDLTKDPVDSKGGTTDAAPAAAASPTTGKSASAS
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.