Protein

MCA_01072_1

Length
110 amino acids


Gene name: COX19

Description: Cytochrome c oxidase assembly protein COX19

Browser: contigA:3403913-3404335-

RNA-seq: read pairs 2293, FPKM 255.2, percentile rank 90.6% (100% = highest expression)

Protein function

Annotation:COX19Cytochrome c oxidase assembly protein COX19
KEGG:K18183COX19 cytochrome c oxidase assembly protein subunit 19
EGGNOG:0PRY2COX19Cytochrome c oxidase assembly protein cox19
SGD closest match:S000007245COX19Cytochrome c oxidase assembly protein COX19
CGD closest match:CAL0000176572COX19Cytochrome c oxidase assembly protein COX19

Protein alignments

%idAln lengthE-value
MIA_01518_180.43%923e-51MIA_01518_1
A0A0J9XK26_GEOCN74.19%936e-48Similar to Saccharomyces cerevisiae YLL018C-A COX19 Protein required for cytochrome c oxidase assembly OS=Geotrichum candidum GN=BN980_GECA32s00120g PE=4 SV=1
A0A060TH79_BLAAD66.25%805e-37ARAD1D36630p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D36630g PE=4 SV=1
COX19_YEAST57.73%977e-37Cytochrome c oxidase assembly protein COX19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX19 PE=1 SV=1
UniRef50_Q3E73157.73%972e-33Cytochrome c oxidase assembly protein COX19 n=47 Tax=Opisthokonta TaxID=33154 RepID=COX19_YEAST
A0A1E3PDW6_9ASCO71.43%778e-35Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53268 PE=4 SV=1
B5FVG7_YARLI62.50%882e-33YALI0E34540p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E34540g PE=4 SV=1
COX19_CANAL60.00%806e-33Cytochrome c oxidase assembly protein COX19 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX19 PE=3 SV=2
A0A1E4TJ42_9ASCO56.25%802e-27Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_16218 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0210

Protein family membership

None predicted.

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_01072_1
MASGGPGAGFSNWLPAPPERGSFPLDHDSECSTIMKDYLTCLKLVHGTNAHGCRLLAKSYLKCRMDHGLMDHDEWKNLGL
PEDDKPIIPRKLDDPSSNKSTESTNQSPPS

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.