Protein

MIA_01463_1

Length
151 amino acids


Browser: contig02:796152-796608+

Protein function

EGGNOG:0PSDMGRX2Glutaredoxin
SGD closest match:S000002921GRX2Glutaredoxin-2, mitochondrial
CGD closest match:CAL0000190988TTR1Dithiol glutaredoxin

Protein alignments

%idAln lengthE-value
Q5ABB1_CANAL56.140%1141.58e-41Dithiol glutaredoxin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TTR1 PE=4 SV=1
UniRef50_C4R93458.333%1081.34e-36Cytoplasmic glutaredoxin, thioltransferase, glutathione-dependent disulfide oxidoreductase n=31 Tax=cellular organisms TaxID=131567 RepID=C4R934_KOMPG
Q6CCY8_YARLI56.731%1041.01e-39YALI0C05467p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C05467g PE=4 SV=1
GLRX2_YEAST52.252%1111.85e-37Glutaredoxin-2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX2 PE=1 SV=3
A0A0J9X659_GEOCN48.227%1419.27e-35Similar to Saccharomyces cerevisiae YDR513W GRX2 Cytoplasmic glutaredoxin, thioltransferase,glutathione-dependent disulfide oxidoreductase involved in maintaining redox state of target proteins OS=Geotrichum candidum GN=BN980_GECA03s06071g PE=4 SV=1
A0A1E3PPX6_9ASCO44.526%1372.17e-34Glutaredoxin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49350 PE=4 SV=1
A0A060TC62_BLAAD42.593%1082.32e-29ARAD1B20702p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B20702g PE=4 SV=1
MCA_05606_155.102%985.58e-27MCA_05606_1
A0A167DUM9_9ASCO36.697%1098.73e-21Dithiol glutaredoxin GRX2 OS=Sugiyamaella lignohabitans GN=GRX2 PE=4 SV=1
A0A1E4TCR7_9ASCO39.362%947.82e-20Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13921 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0727

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 151

Detailed signature matches

    1. SSF52833 (Thioredox...)
    1. PF00462 (Glutaredoxin)
    2. PS51354 (GLUTAREDOX...)
    1. PR00160 (GLUTAREDOXIN)
    1. PS00195 (GLUTAREDOX...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SFLDG00328 (Glutare...)
  2. TRANSMEMBRANE (Tran...)
  3. cd03419 (GRX_GRXh_1...)

Residue annotation

  1. GSH binding site c...
  2. SFLDG00328
  3. catalytic residues...

Protein sequence

>MIA_01463_1
MDATKDSFDYSPSSSLTLSTIIFYAIPLFMVLKSLYTYFFASPKMVSPATLAKTQALINSSKVFVASKSYCPYCKATKNL
LNQLGVHSATIIELNEIEDGAEIQDALQQITGQRTVPNIFIAGKHIGGNSDIQALNSRDELVPALKAAGAL

GO term prediction

Biological Process

GO:0045454 cell redox homeostasis

Molecular Function

GO:0009055 electron carrier activity
GO:0015035 protein disulfide oxidoreductase activity

Cellular Component

None predicted.